Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02182
Gene name
Locationscaffold_02:2849624..2850554
Strand-
Gene length (bp)930
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 2.1E-13 35 158

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.4418 0.1941 0.7008 0.1668 0.3666 0.5948 0.3499 0.3342 0.2352 0.2109

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup8149
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02182 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1480

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02182
MFQQLFHLGVSLPGLGRFVFNQTHQASTAAIVERRSVDAPDYCFRVDSRSPQEIIADGGFRPALNTRDYQDERVF
SIYIHTQFPRSPSGSAYVSITTEPGVALRVASPGHYIYRLICPPNSLDVNTALGVLSRTPWQHERVVLGGVPSRY
IVGWLEFRDRIRKPVSSARHVAKLNQKCKEKYSRLFTPNPGFDTGLMSARNSFDDWIYKVFAWVLAGFWPSSDRH
SYANVSPWCRYRDWDLADGARRFMDRFGGPVGWMAGQDFPLWECRPDYERGECRATEPKVWAKGEVRSDKYEAAL
VGTKCLPNS*
Coding >Ophcf2|02182
ATGTTCCAACAACTCTTTCACTTGGGCGTCAGCCTTCCTGGCCTAGGTCGTTTCGTCTTTAACCAGACTCACCAG
GCGTCAACGGCTGCCATTGTCGAACGTAGGTCCGTAGACGCTCCGGACTACTGCTTCCGCGTCGACTCCAGGTCG
CCGCAAGAAATCATCGCAGATGGCGGCTTCAGACCCGCTCTAAACACAAGAGATTATCAAGACGAGCGCGTGTTT
AGCATCTACATCCATACGCAGTTCCCCCGGAGCCCCTCGGGATCAGCCTACGTGTCCATCACGACAGAGCCCGGC
GTTGCGCTGCGCGTCGCCTCGCCGGGCCACTACATTTACCGTCTCATATGTCCGCCCAACTCGCTCGACGTGAAT
ACGGCGCTCGGTGTGTTGTCGCGGACGCCGTGGCAGCATGAGCGTGTGGTGTTGGGGGGGGTTCCCAGCCGATAC
ATCGTCGGCTGGCTTGAGTTCCGTGACCGGATTCGAAAGCCCGTTAGCTCGGCTAGGCATGTCGCCAAGTTGAAC
CAGAAGTGCAAGGAGAAGTACAGTCGGCTATTCACGCCGAACCCTGGCTTTGACACGGGCTTGATGTCGGCTAGG
AACTCGTTTGACGATTGGATATACAAGGTGTTTGCGTGGGTGCTGGCCGGCTTCTGGCCGTCGTCTGACCGTCAT
TCGTACGCGAATGTGTCTCCATGGTGTCGATATCGGGATTGGGATCTCGCTGACGGGGCCCGCCGCTTCATGGAC
CGCTTCGGTGGGCCCGTCGGCTGGATGGCCGGTCAGGACTTTCCCCTGTGGGAATGCAGGCCGGATTACGAGCGG
GGGGAGTGTCGTGCCACGGAGCCCAAGGTTTGGGCCAAGGGCGAGGTTAGGAGCGATAAGTATGAGGCCGCGCTG
GTGGGAACCAAGTGTTTGCCAAACAGCTGA
Transcript >Ophcf2|02182
ATGTTCCAACAACTCTTTCACTTGGGCGTCAGCCTTCCTGGCCTAGGTCGTTTCGTCTTTAACCAGACTCACCAG
GCGTCAACGGCTGCCATTGTCGAACGTAGGTCCGTAGACGCTCCGGACTACTGCTTCCGCGTCGACTCCAGGTCG
CCGCAAGAAATCATCGCAGATGGCGGCTTCAGACCCGCTCTAAACACAAGAGATTATCAAGACGAGCGCGTGTTT
AGCATCTACATCCATACGCAGTTCCCCCGGAGCCCCTCGGGATCAGCCTACGTGTCCATCACGACAGAGCCCGGC
GTTGCGCTGCGCGTCGCCTCGCCGGGCCACTACATTTACCGTCTCATATGTCCGCCCAACTCGCTCGACGTGAAT
ACGGCGCTCGGTGTGTTGTCGCGGACGCCGTGGCAGCATGAGCGTGTGGTGTTGGGGGGGGTTCCCAGCCGATAC
ATCGTCGGCTGGCTTGAGTTCCGTGACCGGATTCGAAAGCCCGTTAGCTCGGCTAGGCATGTCGCCAAGTTGAAC
CAGAAGTGCAAGGAGAAGTACAGTCGGCTATTCACGCCGAACCCTGGCTTTGACACGGGCTTGATGTCGGCTAGG
AACTCGTTTGACGATTGGATATACAAGGTGTTTGCGTGGGTGCTGGCCGGCTTCTGGCCGTCGTCTGACCGTCAT
TCGTACGCGAATGTGTCTCCATGGTGTCGATATCGGGATTGGGATCTCGCTGACGGGGCCCGCCGCTTCATGGAC
CGCTTCGGTGGGCCCGTCGGCTGGATGGCCGGTCAGGACTTTCCCCTGTGGGAATGCAGGCCGGATTACGAGCGG
GGGGAGTGTCGTGCCACGGAGCCCAAGGTTTGGGCCAAGGGCGAGGTTAGGAGCGATAAGTATGAGGCCGCGCTG
GTGGGAACCAAGTGTTTGCCAAACAGCTGA
Gene >Ophcf2|02182
ATGTTCCAACAACTCTTTCACTTGGGCGTCAGCCTTCCTGGCCTAGGTCGTTTCGTCTTTAACCAGACTCACCAG
GCGTCAACGGCTGCCATTGTCGAACGTAGGTCCGTAGACGCTCCGGACTACTGCTTCCGCGTCGACTCCAGGTCG
CCGCAAGAAATCATCGCAGATGGCGGCTTCAGACCCGCTCTAAACACAAGAGATTATCAAGACGAGCGCGTGTTT
AGCATCTACATCCATACGCAGTTCCCCCGGAGCCCCTCGGGATCAGCCTACGTGTCCATCACGACAGAGCCCGGC
GTTGCGCTGCGCGTCGCCTCGCCGGGCCACTACATTTACCGTCTCATATGTCCGCCCAACTCGCTCGACGTGAAT
ACGGCGCTCGGTGTGTTGTCGCGGACGCCGTGGCAGCATGAGCGTGTGGTGTTGGGGGGGGTTCCCAGCCGATAC
ATCGTCGGCTGGCTTGAGTTCCGTGACCGGATTCGAAAGCCCGTTAGCTCGGCTAGGCATGTCGCCAAGTTGAAC
CAGAAGTGCAAGGAGAAGTACAGTCGGCTATTCACGCCGAACCCTGGCTTTGACACGGGCTTGATGTCGGCTAGG
AACTCGTTTGACGATTGGATATACAAGGTGTTTGCGTGGGTGCTGGCCGGCTTCTGGCCGTCGTCTGACCGTCAT
TCGTACGCGAATGTGTCTCCATGGTGTCGATATCGGGATTGGGATCTCGCTGACGGGGCCCGCCGCTTCATGGAC
CGCTTCGGTGGGCCCGTCGGCTGGATGGCCGGTCAGGACTTTCCCCTGTGGGAATGCAGGCCGGATTACGAGCGG
GGGGAGTGTCGTGCCACGGAGCCCAAGGTTTGGGCCAAGGGCGAGGTTAGGAGCGATAAGTATGAGGCCGCGCTG
GTGGGAACCAAGTGTTTGCCAAACAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail