Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02181
Gene name
Locationscaffold_02:2843071..2849044
Strand-
Gene length (bp)5973
Transcript length (bp)5499
Coding sequence length (bp)5499
Protein length (aa) 1833

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 2.7E-151 1380 1806
PF01822 WSC WSC domain 2.7E-15 914 992
PF01822 WSC WSC domain 2.3E-13 1037 1111
PF01822 WSC WSC domain 4.2E-12 1181 1243

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1291 0.1406 0.1406 0.0327 0.5668 0.1255 0.1184 0.0747 0.0861 0.0196

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999746

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705
Ophiocordyceps camponoti-floridani Ophcf2|02181 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1479
Ophiocordyceps kimflemingae Ophio5|2863
Ophiocordyceps kimflemingae Ophio5|2864
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02181
MKPLLLSALVGLVRALASTDTITWGGDGSRAGYQPNHNMDPAVVASPQFGQLFGTLLPGSFASQPEQIFSQPLVY
TPAGGRQFVYVATTLNNVYKLDAKTGAILASRTLHLPFLAADLDGCNDINPAVGIISTGTIDPATDTLYLTAKTY
VDQTLFGRPQGRPAGRYYVHALDVNDLTERPNFPVNLEGLLARNNPSRMFTGGIHLQRPALLLAGQYLYAGFASH
CVQYNFTGWMIGLEKSSGAVVERWATEGAGVPDTVRGGGIWMSGGGPSYDGAGSIFLATGNGYASQLSTIPVRGY
DPPTSLEEAALHMTVNSDGSLNLVDFFMPWEKQAMDGADKDLGTSPLEILPSQFACGDVKRIGVVTAKTGKTYWL
NLDNLGGYRNGKDGLDDIIQSYQNENSVYSGAGVYPLEGGYVYINVIQYPTSVFKFSCNGGVPAFAKVAVSPTPN
AYVLGVGHASVTSMADEPGTALLWVTDVQGPGVRVYDAVPRDGSLVIVNSFNVPGVTKFSRAVFGDGVMYVGTTT
GFVYGFGSPVNSPLNCTSPLDFGTVDIRATSDVKAVVCRAVVDLTVMGLGLADGRNFVLSESPMLPLKLSQGQSF
VVNARFGPSTVGLLSVDIVANTTNGAAGFSTNTHARLVGTGRSVGPLLAVSPNTLSFPGVVAGQDPNGVSETVVV
SNRGNAALIIRSILYSADNSTAPRTYDGQGDLVVGRFTLQKLPKTVAANAGSAINVLFNSSISGTFSATIRFVTD
GGNASVTIYASSGPAPVALLEFQTIDGQGWVRYEPGTPFSFGNVTENSSRSLKFRITNAAPTGGVKLSLTVSKPP
FGVSGLVKAVNQVDLAEGSSFAPGQSATAILTCTAPKSQWNVDAYNGTSQWTLNTNDPTLGKQFVRFFCNAVAEQ
TPPLLSVGRGQYRYAGCFKDNTPERQLPNQVVADDGLTNAMCIAACAKSNYVFCGTEYLRECWAGDRVPMQKVED
ENCNYNCAGAINQICGGNGVNDGAGGAYISLFADSLRWDGNLTRPPPPGPAVNPGVAGFTSMGCYTEGNPGRALP
NGVNTNKRTVAACVDACKAATYTMAGVEYGGECWCGNVLGTGSVPAPAADCAMTCNEYCGGPSRLNVYRLGSPAG
STSSTGMNTPSSTASTPRTSSSTTVVTTSTTTSSSSSSALTPTGPAVKKTVGRYSFQGCWTEATNGRALGGNAYA
DDKMTLESCAVFCNGFRYFATEYGRECYCGDGLGGGSVQAVNQNDFVVSSGVEGYFSVSTTRQERRRTHYGLEDD
VGSAFQSPETRRRRRSSKWGSSDYLGRFRSFVAYKRTSKSGLEPTNTTLQSLNIRTALGTMLRPRSSWLPRAAKV
KGHRLWSSGPKKEGDISDSFVSLSGTERGALPDRFRQLKCELVRGREKSFVDGWTRLLGQLRAENEFIAQKGSGV
IPQVDVEDLDGGCEEGVRDEIKKRGVVVVKGVVPEDEARRYKFELDEYIAKNPQTRAFPAHDPQVYELYWSGPQL
KARAHPSLLLVQRQLMSLFWHSAADACVSLANPVTYADRLRIRKAGDASFALGPHMDGGSVERWEREGYGRGGVY
DSILSGAWEEHDGWDAGRRVEAVNNRYDGLGACSVFRAWQGWMAMSSCGPGQGTLLVNPLPKLSTAYVLLRPFFR
PVEGNGGSMSRDGFLHPSNWDLMAGEDMTSELQGAWPGFGQELSEELHPHLELERSMVHIPDIRPGDFVAWHCDV
IHSVDKIHRGSSDSSVLYIPVCPATEANGEYVLRQREAFRRGTPAPDFPGGEGESRHAGRPDPEEARAWAPTTEG
RQAFGLERLMVRDGAGRGEREAVRRVNAVLGL*
Coding >Ophcf2|02181
ATGAAGCCTCTCTTGCTTTCGGCTCTCGTCGGCCTTGTCCGTGCCCTCGCTTCGACGGATACCATCACTTGGGGT
GGCGATGGCTCTCGAGCGGGATACCAGCCCAACCACAACATGGACCCGGCCGTCGTCGCCAGCCCCCAGTTCGGC
CAGCTCTTCGGCACTCTCCTCCCGGGTTCCTTCGCCTCGCAGCCCGAGCAGATCTTCTCGCAGCCGCTCGTCTAC
ACGCCCGCTGGAGGCCGCCAGTTCGTCTACGTCGCCACGACGCTCAACAACGTGTACAAGCTGGATGCCAAGACG
GGAGCCATCCTCGCCTCACGAACTCTTCATCTGCCTTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATCAAT
CCGGCCGTGGGCATCATCTCGACCGGCACGATCGATCCGGCTACCGACACCCTCTATCTCACGGCCAAGACGTAC
GTCGATCAGACGCTTTTCGGTCGACCTCAGGGCCGGCCCGCTGGTCGCTACTATGTCCACGCTCTTGATGTCAAC
GACCTGACTGAGCGTCCCAACTTTCCCGTCAATCTCGAGGGCCTACTGGCAAGGAATAATCCGTCTCGCATGTTC
ACCGGCGGCATCCACCTCCAACGGCCCGCTTTGCTTCTCGCCGGCCAGTACCTGTACGCCGGCTTCGCCTCTCAC
TGCGTCCAGTACAACTTCACCGGCTGGATGATAGGGTTGGAAAAGTCCTCGGGAGCCGTCGTCGAGCGCTGGGCC
ACCGAGGGCGCTGGTGTGCCTGATACAGTTCGGGGCGGCGGCATCTGGATGTCTGGTGGTGGCCCTTCCTACGAC
GGTGCCGGTTCCATCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACCATTCCCGTCAGGGGGTAT
GACCCTCCCACCTCGCTCGAGGAGGCGGCGCTGCACATGACGGTGAACTCGGATGGGAGTCTGAACCTCGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCAATGGACGGCGCCGACAAGGACCTAGGCACCAGCCCCCTCGAGATCCTG
CCCTCTCAGTTCGCCTGCGGAGACGTCAAACGAATCGGCGTCGTCACGGCAAAAACCGGCAAGACGTATTGGTTG
AACCTCGATAATCTGGGCGGCTATAGGAATGGAAAGGACGGCTTGGACGACATCATTCAGTCCTATCAAAACGAA
AACTCCGTCTACAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTACGTCTACATCAACGTCATCCAATACCCG
ACTTCCGTCTTCAAGTTCTCGTGCAACGGAGGCGTTCCCGCCTTCGCCAAGGTCGCCGTCTCGCCCACGCCCAAC
GCCTACGTCCTCGGCGTCGGCCACGCCTCCGTCACCTCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTC
ACCGACGTGCAGGGACCGGGCGTCCGAGTCTACGACGCTGTGCCCAGGGATGGAAGCCTCGTCATTGTCAACTCG
TTCAACGTACCCGGCGTCACCAAGTTTTCCCGCGCCGTCTTCGGTGACGGAGTCATGTATGTCGGCACGACGACT
GGTTTCGTCTACGGTTTCGGCTCTCCGGTCAACTCCCCGCTGAATTGCACCTCGCCCCTGGACTTTGGCACCGTC
GACATCAGGGCCACCAGCGACGTCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCATGGGCCTCGGG
CTGGCCGACGGCAGGAACTTTGTTCTCTCCGAGTCGCCGATGCTGCCTCTGAAGCTGTCACAGGGGCAGTCGTTT
GTCGTGAATGCCAGATTCGGCCCCTCGACCGTCGGCCTCTTGTCGGTCGATATAGTTGCCAACACGACAAACGGA
GCCGCCGGCTTCAGCACAAACACCCACGCGCGCCTGGTCGGGACCGGCCGCAGCGTCGGCCCGCTCTTGGCCGTC
AGCCCCAATACCCTTTCGTTCCCCGGCGTCGTAGCCGGTCAGGATCCCAATGGCGTTTCCGAGACGGTCGTCGTC
TCCAACAGGGGCAACGCCGCCCTGATCATCAGGTCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCGGACG
TATGACGGCCAGGGAGACCTCGTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAAGACGGTGGCCGCCAACGCC
GGGAGCGCCATCAACGTGCTCTTCAACTCGTCTATCAGCGGTACCTTTTCGGCCACAATCAGGTTCGTCACCGAC
GGCGGAAACGCGAGCGTCACCATCTACGCTTCGTCCGGGCCGGCTCCCGTTGCCCTGCTTGAGTTTCAGACCATC
GACGGCCAAGGATGGGTCAGATACGAACCCGGAACTCCATTCAGTTTCGGCAACGTTACGGAGAATTCGTCGAGG
TCTCTCAAGTTCCGCATCACCAACGCCGCGCCGACGGGCGGCGTGAAGCTGTCCTTGACGGTGTCGAAACCCCCT
TTCGGCGTCAGCGGCCTGGTCAAGGCTGTCAACCAGGTCGACCTGGCCGAGGGCTCCTCGTTCGCGCCGGGGCAG
AGCGCAACGGCGATCCTGACCTGTACGGCGCCCAAGTCCCAGTGGAACGTCGATGCCTATAATGGCACCTCGCAG
TGGACGCTCAACACCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAG
ACGCCGCCTCTGCTTTCGGTCGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGT
CAGCTGCCCAACCAGGTCGTTGCCGACGATGGCCTCACGAACGCCATGTGCATCGCCGCGTGTGCCAAAAGTAAC
TACGTCTTCTGTGGCACCGAATATCTGCGCGAGTGCTGGGCCGGTGACCGGGTTCCCATGCAAAAAGTCGAAGAC
GAGAACTGCAATTATAACTGTGCCGGCGCCATCAACCAGATATGCGGCGGCAACGGCGTCAATGACGGAGCTGGC
GGTGCCTACATATCGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCC
GCCGTCAACCCGGGGGTTGCGGGCTTTACCAGCATGGGATGCTACACCGAAGGCAACCCGGGCCGGGCGTTGCCG
AACGGCGTCAATACCAATAAGAGGACGGTGGCCGCGTGTGTGGATGCCTGCAAGGCGGCGACCTATACCATGGCC
GGCGTCGAGTACGGAGGCGAGTGCTGGTGCGGGAATGTCCTCGGAACCGGCTCTGTGCCTGCTCCTGCGGCTGAC
TGTGCCATGACGTGCAACGAGTACTGCGGCGGACCGTCAAGGCTCAATGTTTACCGGCTGGGGTCTCCCGCGGGC
TCGACGTCGTCGACCGGTATGAACACGCCCTCGAGCACCGCCTCGACGCCCAGGACTTCATCCTCGACTACGGTC
GTCACAACATCCACAACGACCAGTAGCAGCAGCTCTTCAGCGCTGACTCCGACCGGACCGGCGGTCAAGAAGACG
GTCGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGGACGGGCCCTGGGGGGGAACGCGTACGCG
GATGACAAAATGACGCTCGAATCTTGCGCCGTTTTCTGCAACGGGTTCCGATACTTTGCCACCGAATACGGACGG
GAATGCTACTGCGGCGACGGCCTCGGCGGTGGGAGCGTCCAGGCTGTGAACCAGAACGACTTCGTGGTGAGCAGT
GGTGTTGAGGGCTACTTTAGCGTATCGACAACGCGACAAGAGAGAAGACGGACTCATTATGGCCTCGAGGACGAC
GTTGGCTCGGCGTTTCAAAGCCCCGAAACTCGGCGACGGAGGCGGAGTTCCAAATGGGGTAGCTCCGACTACCTT
GGACGTTTCCGTTCCTTCGTTGCCTACAAAAGGACCTCCAAGTCTGGACTCGAGCCAACGAACACGACGTTGCAG
TCTCTGAATATTCGTACGGCTCTTGGCACCATGTTACGTCCCCGCTCGAGTTGGCTTCCAAGGGCTGCCAAGGTC
AAGGGCCATCGGCTTTGGTCGAGCGGCCCCAAGAAGGAGGGCGACATCTCGGACTCGTTCGTCTCCCTCTCCGGG
ACTGAGCGAGGTGCGCTACCCGACAGATTCAGACAGCTCAAGTGCGAGTTGGTGAGGGGACGTGAGAAGAGCTTC
GTCGATGGATGGACGAGGCTGCTTGGGCAGCTGAGGGCTGAGAATGAGTTCATAGCCCAGAAGGGGTCGGGTGTC
ATACCTCAGGTTGACGTCGAGGATCTTGATGGAGGCTGCGAGGAGGGTGTCAGGGATGAGATTAAGAAGAGAGGG
GTTGTTGTCGTCAAGGGGGTGGTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCG
AAGAATCCACAGACCCGAGCCTTTCCCGCACACGATCCACAGGTGTATGAACTGTACTGGTCCGGGCCCCAGCTC
AAGGCACGGGCTCACCCGTCGCTTCTGCTCGTACAACGGCAACTCATGAGCCTCTTCTGGCACTCTGCCGCGGAC
GCCTGCGTGTCTCTGGCAAACCCGGTGACGTACGCGGATCGGTTGCGGATCCGGAAGGCCGGCGACGCTTCCTTC
GCCCTGGGCCCGCATATGGACGGCGGTAGCGTCGAGAGATGGGAGCGTGAGGGCTATGGCCGTGGCGGCGTCTAC
GATTCGATACTCTCGGGGGCGTGGGAGGAGCATGATGGCTGGGACGCTGGTCGGAGGGTTGAGGCTGTTAATAAC
CGGTATGATGGTCTCGGCGCCTGCTCCGTCTTCCGCGCGTGGCAGGGGTGGATGGCTATGAGCTCGTGTGGTCCG
GGACAGGGGACTCTGCTGGTGAACCCGTTGCCGAAGCTGTCGACTGCCTACGTTCTGTTGCGGCCATTTTTCCGG
CCGGTGGAAGGGAACGGGGGGTCGATGTCAAGAGATGGTTTCTTGCATCCGTCGAACTGGGACCTGATGGCTGGA
GAGGATATGACGTCGGAGCTTCAGGGGGCTTGGCCGGGATTCGGTCAGGAGCTGAGTGAGGAGTTGCATCCGCAT
CTGGAGCTGGAGAGAAGCATGGTGCATATCCCGGATATAAGGCCCGGAGATTTCGTGGCGTGGCATTGCGATGTC
ATCCACTCCGTCGATAAAATCCACCGCGGCTCGTCCGACTCGAGCGTGCTTTACATTCCCGTCTGTCCGGCCACG
GAGGCTAACGGCGAGTACGTGCTCCGGCAGAGGGAGGCCTTCCGTCGGGGCACGCCGGCGCCTGACTTTCCCGGG
GGAGAGGGCGAATCGCGGCACGCGGGCCGGCCGGATCCGGAAGAGGCCCGTGCTTGGGCTCCGACAACAGAGGGT
AGGCAGGCTTTTGGGCTGGAGAGGTTGATGGTTAGGGATGGGGCGGGGAGAGGGGAGAGGGAGGCGGTTCGGAGG
GTGAATGCCGTTCTCGGACTTTAG
Transcript >Ophcf2|02181
ATGAAGCCTCTCTTGCTTTCGGCTCTCGTCGGCCTTGTCCGTGCCCTCGCTTCGACGGATACCATCACTTGGGGT
GGCGATGGCTCTCGAGCGGGATACCAGCCCAACCACAACATGGACCCGGCCGTCGTCGCCAGCCCCCAGTTCGGC
CAGCTCTTCGGCACTCTCCTCCCGGGTTCCTTCGCCTCGCAGCCCGAGCAGATCTTCTCGCAGCCGCTCGTCTAC
ACGCCCGCTGGAGGCCGCCAGTTCGTCTACGTCGCCACGACGCTCAACAACGTGTACAAGCTGGATGCCAAGACG
GGAGCCATCCTCGCCTCACGAACTCTTCATCTGCCTTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATCAAT
CCGGCCGTGGGCATCATCTCGACCGGCACGATCGATCCGGCTACCGACACCCTCTATCTCACGGCCAAGACGTAC
GTCGATCAGACGCTTTTCGGTCGACCTCAGGGCCGGCCCGCTGGTCGCTACTATGTCCACGCTCTTGATGTCAAC
GACCTGACTGAGCGTCCCAACTTTCCCGTCAATCTCGAGGGCCTACTGGCAAGGAATAATCCGTCTCGCATGTTC
ACCGGCGGCATCCACCTCCAACGGCCCGCTTTGCTTCTCGCCGGCCAGTACCTGTACGCCGGCTTCGCCTCTCAC
TGCGTCCAGTACAACTTCACCGGCTGGATGATAGGGTTGGAAAAGTCCTCGGGAGCCGTCGTCGAGCGCTGGGCC
ACCGAGGGCGCTGGTGTGCCTGATACAGTTCGGGGCGGCGGCATCTGGATGTCTGGTGGTGGCCCTTCCTACGAC
GGTGCCGGTTCCATCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACCATTCCCGTCAGGGGGTAT
GACCCTCCCACCTCGCTCGAGGAGGCGGCGCTGCACATGACGGTGAACTCGGATGGGAGTCTGAACCTCGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCAATGGACGGCGCCGACAAGGACCTAGGCACCAGCCCCCTCGAGATCCTG
CCCTCTCAGTTCGCCTGCGGAGACGTCAAACGAATCGGCGTCGTCACGGCAAAAACCGGCAAGACGTATTGGTTG
AACCTCGATAATCTGGGCGGCTATAGGAATGGAAAGGACGGCTTGGACGACATCATTCAGTCCTATCAAAACGAA
AACTCCGTCTACAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTACGTCTACATCAACGTCATCCAATACCCG
ACTTCCGTCTTCAAGTTCTCGTGCAACGGAGGCGTTCCCGCCTTCGCCAAGGTCGCCGTCTCGCCCACGCCCAAC
GCCTACGTCCTCGGCGTCGGCCACGCCTCCGTCACCTCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTC
ACCGACGTGCAGGGACCGGGCGTCCGAGTCTACGACGCTGTGCCCAGGGATGGAAGCCTCGTCATTGTCAACTCG
TTCAACGTACCCGGCGTCACCAAGTTTTCCCGCGCCGTCTTCGGTGACGGAGTCATGTATGTCGGCACGACGACT
GGTTTCGTCTACGGTTTCGGCTCTCCGGTCAACTCCCCGCTGAATTGCACCTCGCCCCTGGACTTTGGCACCGTC
GACATCAGGGCCACCAGCGACGTCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCATGGGCCTCGGG
CTGGCCGACGGCAGGAACTTTGTTCTCTCCGAGTCGCCGATGCTGCCTCTGAAGCTGTCACAGGGGCAGTCGTTT
GTCGTGAATGCCAGATTCGGCCCCTCGACCGTCGGCCTCTTGTCGGTCGATATAGTTGCCAACACGACAAACGGA
GCCGCCGGCTTCAGCACAAACACCCACGCGCGCCTGGTCGGGACCGGCCGCAGCGTCGGCCCGCTCTTGGCCGTC
AGCCCCAATACCCTTTCGTTCCCCGGCGTCGTAGCCGGTCAGGATCCCAATGGCGTTTCCGAGACGGTCGTCGTC
TCCAACAGGGGCAACGCCGCCCTGATCATCAGGTCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCGGACG
TATGACGGCCAGGGAGACCTCGTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAAGACGGTGGCCGCCAACGCC
GGGAGCGCCATCAACGTGCTCTTCAACTCGTCTATCAGCGGTACCTTTTCGGCCACAATCAGGTTCGTCACCGAC
GGCGGAAACGCGAGCGTCACCATCTACGCTTCGTCCGGGCCGGCTCCCGTTGCCCTGCTTGAGTTTCAGACCATC
GACGGCCAAGGATGGGTCAGATACGAACCCGGAACTCCATTCAGTTTCGGCAACGTTACGGAGAATTCGTCGAGG
TCTCTCAAGTTCCGCATCACCAACGCCGCGCCGACGGGCGGCGTGAAGCTGTCCTTGACGGTGTCGAAACCCCCT
TTCGGCGTCAGCGGCCTGGTCAAGGCTGTCAACCAGGTCGACCTGGCCGAGGGCTCCTCGTTCGCGCCGGGGCAG
AGCGCAACGGCGATCCTGACCTGTACGGCGCCCAAGTCCCAGTGGAACGTCGATGCCTATAATGGCACCTCGCAG
TGGACGCTCAACACCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAG
ACGCCGCCTCTGCTTTCGGTCGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGT
CAGCTGCCCAACCAGGTCGTTGCCGACGATGGCCTCACGAACGCCATGTGCATCGCCGCGTGTGCCAAAAGTAAC
TACGTCTTCTGTGGCACCGAATATCTGCGCGAGTGCTGGGCCGGTGACCGGGTTCCCATGCAAAAAGTCGAAGAC
GAGAACTGCAATTATAACTGTGCCGGCGCCATCAACCAGATATGCGGCGGCAACGGCGTCAATGACGGAGCTGGC
GGTGCCTACATATCGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCC
GCCGTCAACCCGGGGGTTGCGGGCTTTACCAGCATGGGATGCTACACCGAAGGCAACCCGGGCCGGGCGTTGCCG
AACGGCGTCAATACCAATAAGAGGACGGTGGCCGCGTGTGTGGATGCCTGCAAGGCGGCGACCTATACCATGGCC
GGCGTCGAGTACGGAGGCGAGTGCTGGTGCGGGAATGTCCTCGGAACCGGCTCTGTGCCTGCTCCTGCGGCTGAC
TGTGCCATGACGTGCAACGAGTACTGCGGCGGACCGTCAAGGCTCAATGTTTACCGGCTGGGGTCTCCCGCGGGC
TCGACGTCGTCGACCGGTATGAACACGCCCTCGAGCACCGCCTCGACGCCCAGGACTTCATCCTCGACTACGGTC
GTCACAACATCCACAACGACCAGTAGCAGCAGCTCTTCAGCGCTGACTCCGACCGGACCGGCGGTCAAGAAGACG
GTCGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGGACGGGCCCTGGGGGGGAACGCGTACGCG
GATGACAAAATGACGCTCGAATCTTGCGCCGTTTTCTGCAACGGGTTCCGATACTTTGCCACCGAATACGGACGG
GAATGCTACTGCGGCGACGGCCTCGGCGGTGGGAGCGTCCAGGCTGTGAACCAGAACGACTTCGTGGTGAGCAGT
GGTGTTGAGGGCTACTTTAGCGTATCGACAACGCGACAAGAGAGAAGACGGACTCATTATGGCCTCGAGGACGAC
GTTGGCTCGGCGTTTCAAAGCCCCGAAACTCGGCGACGGAGGCGGAGTTCCAAATGGGGTAGCTCCGACTACCTT
GGACGTTTCCGTTCCTTCGTTGCCTACAAAAGGACCTCCAAGTCTGGACTCGAGCCAACGAACACGACGTTGCAG
TCTCTGAATATTCGTACGGCTCTTGGCACCATGTTACGTCCCCGCTCGAGTTGGCTTCCAAGGGCTGCCAAGGTC
AAGGGCCATCGGCTTTGGTCGAGCGGCCCCAAGAAGGAGGGCGACATCTCGGACTCGTTCGTCTCCCTCTCCGGG
ACTGAGCGAGGTGCGCTACCCGACAGATTCAGACAGCTCAAGTGCGAGTTGGTGAGGGGACGTGAGAAGAGCTTC
GTCGATGGATGGACGAGGCTGCTTGGGCAGCTGAGGGCTGAGAATGAGTTCATAGCCCAGAAGGGGTCGGGTGTC
ATACCTCAGGTTGACGTCGAGGATCTTGATGGAGGCTGCGAGGAGGGTGTCAGGGATGAGATTAAGAAGAGAGGG
GTTGTTGTCGTCAAGGGGGTGGTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCG
AAGAATCCACAGACCCGAGCCTTTCCCGCACACGATCCACAGGTGTATGAACTGTACTGGTCCGGGCCCCAGCTC
AAGGCACGGGCTCACCCGTCGCTTCTGCTCGTACAACGGCAACTCATGAGCCTCTTCTGGCACTCTGCCGCGGAC
GCCTGCGTGTCTCTGGCAAACCCGGTGACGTACGCGGATCGGTTGCGGATCCGGAAGGCCGGCGACGCTTCCTTC
GCCCTGGGCCCGCATATGGACGGCGGTAGCGTCGAGAGATGGGAGCGTGAGGGCTATGGCCGTGGCGGCGTCTAC
GATTCGATACTCTCGGGGGCGTGGGAGGAGCATGATGGCTGGGACGCTGGTCGGAGGGTTGAGGCTGTTAATAAC
CGGTATGATGGTCTCGGCGCCTGCTCCGTCTTCCGCGCGTGGCAGGGGTGGATGGCTATGAGCTCGTGTGGTCCG
GGACAGGGGACTCTGCTGGTGAACCCGTTGCCGAAGCTGTCGACTGCCTACGTTCTGTTGCGGCCATTTTTCCGG
CCGGTGGAAGGGAACGGGGGGTCGATGTCAAGAGATGGTTTCTTGCATCCGTCGAACTGGGACCTGATGGCTGGA
GAGGATATGACGTCGGAGCTTCAGGGGGCTTGGCCGGGATTCGGTCAGGAGCTGAGTGAGGAGTTGCATCCGCAT
CTGGAGCTGGAGAGAAGCATGGTGCATATCCCGGATATAAGGCCCGGAGATTTCGTGGCGTGGCATTGCGATGTC
ATCCACTCCGTCGATAAAATCCACCGCGGCTCGTCCGACTCGAGCGTGCTTTACATTCCCGTCTGTCCGGCCACG
GAGGCTAACGGCGAGTACGTGCTCCGGCAGAGGGAGGCCTTCCGTCGGGGCACGCCGGCGCCTGACTTTCCCGGG
GGAGAGGGCGAATCGCGGCACGCGGGCCGGCCGGATCCGGAAGAGGCCCGTGCTTGGGCTCCGACAACAGAGGGT
AGGCAGGCTTTTGGGCTGGAGAGGTTGATGGTTAGGGATGGGGCGGGGAGAGGGGAGAGGGAGGCGGTTCGGAGG
GTGAATGCCGTTCTCGGACTTTAG
Gene >Ophcf2|02181
ATGAAGCCTCTCTTGCTTTCGGCTCTCGTCGGCCTTGTCCGTGCCCTCGCTTCGACGGATACCATCACTTGGGGT
GGCGATGGCTCTCGAGCGGGATACCAGCCGTTCGTTCATTCGCTTCCGTCCCTTGTTTGCTGACCTTCATCTTAC
TGACTGCGTCTCTCAAGCAACCACAACATGGACCCGGCCGTCGTCGCCAGCCCCCAGTTCGGCCAGCTCTTCGGC
ACTCTCCTCCCGGGTTCCTTCGCCTCGCAGCCCGAGCAGATCTTCTCGCAGCCGCTCGTCTACACGCCCGCTGGA
GGCCGCCAGTTCGTCTACGTCGCCACGACGCTCAACAACGTGTACAAGCTGGATGCCAAGACGGGAGCCATCCTC
GCCTCACGAACTCTTCATCTGCCTTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATCAATCCGGCCGTGGGC
ATCATCTCGACCGGCACGATCGATCCGGCTACCGACACCCTCTATCTCACGGCCAAGACGTACGTCGATCAGACG
CTTTTCGGTCGACCTCAGGGCCGGCCCGCTGGTCGCTACTATGTCCACGCTCTTGATGTCAACGACCTGACTGAG
CGTCCCAACTTTCCCGTCAATCTCGAGGGCCTACTGGCAAGGAATAATCCGTCTCGCATGTTCACCGGCGGCATC
CACCTCCAACGGCCCGCTTTGCTTCTCGCCGGCCAGTACCTGTACGCCGGCTTCGCCTCTCACTGCGTCCAGTAC
AACTTCACCGGCTGGATGATAGGGTTGGAAAAGTCCTCGGGAGCCGTCGTCGAGCGCTGGGCCACCGAGGGCGCT
GGTGTGCCTGATACAGTTCGGGGCGGCGGCATCTGGATGTCTGGTGGTGGCCCTTCCTACGACGGTGCCGGTTCC
ATCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACCATTCCCGTCAGGGGGTATGACCCTCCCACC
TCGCTCGAGGAGGCGGCGCTGCACATGACGGTGAACTCGGATGGGAGTCTGAACCTCGTCGACTTCTTCATGCCC
TGGGAGAAGCAGGCAATGGACGGCGCCGACAAGGACCTAGGCACCAGCCCCCTCGAGATCCTGCCCTCTCAGTTC
GCCTGCGGAGACGTCAAACGAATCGGCGTCGTCACGGCAAAAACCGGCAAGACGTATTGGTTGAACCTCGATAAT
CTGGGCGGCTATAGGAATGGAAAGGACGGCTTGGACGACATCATTCAGTCCTATCAAAACGAAAACTCCGTCTAC
AGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTACGTCTACATCAACGTCATCCAATACCCGACTTCCGTCTTC
AAGTTCTCGTGCAACGGAGGCGTTCCCGCCTTCGCCAAGGTCGCCGTCTCGCCCACGCCCAACGCCTACGTCCTC
GGCGTCGGCCACGCCTCCGTCACCTCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTCACCGACGTGCAG
GGACCGGGCGTCCGAGTCTACGACGCTGTGCCCAGGGATGGAAGCCTCGTCATTGTCAACTCGTTCAACGTACCC
GGCGTCACCAAGTTTTCCCGCGCCGTCTTCGGTGACGGAGTCATGTATGTCGGCACGACGACTGGTTTCGTCTAC
GGTTTCGGCTCTCCGGTCAACTCCCCGCTGAATTGCACCTCGCCCCTGGACTTTGGCACCGTCGACATCAGGGCC
ACCAGCGACGTCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCATGGGCCTCGGGCTGGCCGACGGC
AGGAACTTTGTTCTCTCCGAGTCGCCGATGCTGCCTCTGAAGCTGTCACAGGGGCAGTCGTTTGTCGTGAATGCC
AGATTCGGCCCCTCGACCGTCGGCCTCTTGTCGGTCGATATAGTTGCCAACACGACAAACGGAGCCGCCGGCTTC
AGCACAAACACCCACGCGCGCCTGGTCGGGACCGGCCGCAGCGTCGGCCCGCTCTTGGCCGTCAGCCCCAATACC
CTTTCGTTCCCCGGCGTCGTAGCCGGTCAGGATCCCAATGGCGTTTCCGAGACGGTCGTCGTCTCCAACAGGGGC
AACGCCGCCCTGATCATCAGGTCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCGGACGTATGACGGCCAG
GGAGACCTCGTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAAGACGGTGGCCGCCAACGCCGGGAGCGCCATC
AACGTGCTCTTCAACTCGTCTATCAGCGGTACCTTTTCGGCCACAATCAGGTTCGTCACCGACGGCGGAAACGCG
AGCGTCACCATCTACGCTTCGTCCGGGCCGGCTCCCGTTGCCCTGCTTGAGTTTCAGACCATCGACGGCCAAGGA
TGGGTCAGATACGAACCCGGAACTCCATTCAGTTTCGGCAACGTTACGGAGAATTCGTCGAGGTCTCTCAAGTTC
CGCATCACCAACGCCGCGCCGACGGGCGGCGTGAAGCTGTCCTTGACGGTGTCGAAACCCCCTTTCGGCGTCAGC
GGCCTGGTCAAGGCTGTCAACCAGGTCGACCTGGCCGAGGGCTCCTCGTTCGCGCCGGGGCAGAGCGCAACGGCG
ATCCTGACCTGTACGGCGCCCAAGTCCCAGTGGAACGTCGATGCCTATAATGGCACCTCGCAGTGGACGCTCAAC
ACCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAGACGCCGCCTCTG
CTTTCGGTCGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGTCAGCTGCCCAAC
CAGGTCGTTGCCGACGATGGCCTCACGAACGCCATGTGCATCGCCGCGTGTGCCAAAAGTAACTACGTCTTCTGT
GGCACCGAATATCTGCGCGAGTGCTGGGCCGGTGACCGGGTTCCCATGCAAAAAGTCGAAGACGAGAACTGCAAT
TATAACTGTGCCGGCGCCATCAACCAGATATGCGGCGGCAACGGCGTCAATGACGGAGCTGGCGGTGCCTACATA
TCGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCCGCCGTCAACCCG
GGGGTTGCGGGCTTTACCAGCATGGGATGCTACACCGAAGGCAACCCGGGCCGGGCGTTGCCGAACGGCGTCAAT
ACCAATAAGAGGACGGTGGCCGCGTGTGTGGATGCCTGCAAGGCGGCGACCTATACCATGGCCGGCGTCGAGTAC
GGAGGCGAGGTGAGTCAGAATAGTTCCCCCTCTGATGGTTCTTCGTGTGCTGATCATGGCAGTGCTGGTGCGGGA
ATGTCCTCGGAACCGGCTCTGTGCCTGCTCCTGCGGCTGACTGTGCCATGACGTGCAACGGTGAGAGCTTCGCGT
TCCAAGTATCGACGGGCACTGATGCGAAGCGAAAGATAACTCGACAGAGTACTGCGGCGGACCGTCAAGGCTCAA
TGTTTACCGGCTGGGGTCTCCCGCGGGCTCGACGTCGTCGACCGGTATGAACACGCCCTCGAGCACCGCCTCGAC
GCCCAGGACTTCATCCTCGACTACGGTCGTCACAACATCCACAACGACCAGTAGCAGCAGCTCTTCAGCGCTGAC
TCCGACCGGACCGGCGGTCAAGAAGACGGTCGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGG
ACGGGCCCTGGGGGGGAACGCGTACGCGGATGACAAAATGACGCTCGAATCTTGCGCCGTTTTCTGCAACGGGTT
CCGATACTTTGCCACCGAATACGGACGGGAATGCTACTGCGGCGACGGCCTCGGCGGTGGGAGCGTCCAGGCTGT
GAACCAGAACGACTGTTCGTTTCCGTGTGCCGGTGATAGATTCGAGTTTTGCGGTGCGGGCGTTAGACTTGAGCT
TTACATGGCGACGGGCTCTTGAGGATATTGAGGGGCAGTCGTGGTGAGCAGTGGTGTTGAGGGCTACGTACGTAC
ATATTGATTGAGACAGGAACTTGAAGGGGCGTCGGGAGTGGTTGAGTTTATCCGCACCTTTGGATGTAACTCGCA
AGACTCCTTAGTTTAGCGTATCGACAACGCGACAAGAGAGAAGACGGACTCATTATGGCCTCGAGGACGACGTTG
GCTCGGCGTTTCAAAGCCCCGAAACTCGGCGACGGAGGCGGAGTTCCAAATGGGGTAGCTCCGACTACCTTGGAC
GTTTCCGTTCCTTCGTTGCCTACAAAAGGACCTCCAAGTCTGGACTCGAGCCAACGAACACGACGTTGCAGTCTC
TGAATATTCGTACGGCTCTTGGCACCATGTTACGTCCCCGCTCGAGTTGGCTTCCAAGGGCTGCCAAGGTCAAGG
GCCATCGGCTTTGGTCGAGCGGCCCCAAGAAGGAGGGCGACATCTCGGACTCGTTCGTCTCCCTCTCCGGGACTG
AGCGAGGTGCGCTACCCGACAGATTCAGACAGCTCAAGTGCGAGTTGGTGAGGGGACGTGAGAAGAGCTTCGTCG
ATGGATGGACGAGGCTGCTTGGGCAGCTGAGGGCTGAGAATGAGTTCATAGCCCAGAAGGGGTCGGGTGTCATAC
CTCAGGTTGACGTCGAGGATCTTGATGGAGGCTGCGAGGAGGGTGTCAGGGATGAGATTAAGAAGAGAGGGGTTG
TTGTCGTCAAGGGGGTGGTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCGAAGA
ATCCACAGACCCGAGGTGAGAGGTTCCCTGTCCGTGACCTTCAGGTGTCGTCTAACAAGCCGATAGCCTTTCCCG
CACACGATCCACAGGTGTATGAACTGTACTGGTCCGGGCCCCAGCTCAAGGCACGGGCTCACCCGTCGCTTCTGC
TCGTACAACGGCAACTCATGAGCCTCTTCTGGCACTCTGCCGCGGACGCCTGCGTGTCTCTGGCAAACCCGGTGA
CGTACGCGGATCGGTTGCGGATCCGGAAGGCCGGCGACGCTTCCTTCGCCCTGGGCCCGCATATGGACGGCGGTA
GCGTCGAGAGATGGGAGCGTGAGGGCTATGGCCGTGGCGGCGTCTACGATTCGATACTCTCGGGGGCGTGGGAGG
AGCATGATGGCTGGGACGCTGGTCGGAGGGTTGAGGCTGTTAATAACCGGTATGATGGTCTCGGCGCCTGCTCCG
TCTTCCGCGCGTGGCAGGGGTGGATGGCTATGAGCTCGTGTGGTCCGGGACAGGGGACTCTGCTGGTGAACCCGT
TGCCGAAGCTGTCGACTGCCTACGTTCTGTTGCGGCCATTTTTCCGGCCGGTGGAAGGGAACGGGGGGTCGATGT
CAAGAGATGGTTTCTTGCATCCGTCGAACTGGGACCTGATGGCTGGAGAGGATATGACGTCGGAGCTTCAGGGGG
CTTGGCCGGGATTCGGTCAGGAGCTGAGTGAGGAGTTGCATCCGCATCTGGAGCTGGAGAGAAGCATGGTGCATA
TCCCGGATATAAGGCCCGGAGATTTCGTGGCGTGGCATTGCGATGGTGAGTCTTTCTGTTCTCGTCTTGGCTTTC
AGCTGACAGTGATGGGCTCAAGTCATCCACTCCGTCGATAAAATCCACCGCGGCTCGTCCGACTCGAGCGTGCTT
TACATTCCCGTCTGTCCGGCCACGGAGGCTAACGGCGAGTACGTGCTCCGGCAGAGGGAGGCCTTCCGTCGGGGC
ACGCCGGCGCCTGACTTTCCCGGGGGAGAGGGCGAATCGCGGCACGCGGGCCGGCCGGATCCGGAAGAGGCCCGT
GCTTGGGCTCCGACAACAGAGGGTAGGCAGGCTTTTGGGCTGGAGAGGTTGATGGTTAGGGATGGGGCGGGGAGA
GGGGAGAGGGAGGCGGTTCGGAGGGTGAATGCCGTTCTCGGACTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail