Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02180
Gene name
Locationscaffold_02:2841820..2842339
Strand-
Gene length (bp)519
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09351 DUF1993 Domain of unknown function (DUF1993) 7.3E-51 5 161

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.8468 0.3994 0.0418 0.1231 0.133 0.0027 0.0702 0.1433 0.1636 0.0162

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup702
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3479
Ophiocordyceps australis map64 (Brazil) OphauB2|6704
Ophiocordyceps camponoti-floridani Ophcf2|02180 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1478
Ophiocordyceps kimflemingae Ophio5|2862
Ophiocordyceps subramaniannii Hirsu2|130
Ophiocordyceps subramaniannii Hirsu2|560

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02180
MVYTLYDASIAVAIDALASLTAVLKKAQESPNAARFSEARLAEDMLPLAFQVHVMTDLAQKLYHRLAGQEPLKWE
NSLKDYEQMHGRIAQTEELLSKANKEEVNKHDGETVSVGLGPGKTADMTTTAYVNGYILPNIFFHLTTAYAILRK
EGVQLGKMDYLRPFIGKYVKDV*
Coding >Ophcf2|02180
ATGGTCTACACGCTGTACGACGCCTCCATCGCCGTCGCCATCGACGCGCTCGCCTCCCTCACGGCCGTGCTCAAG
AAGGCGCAGGAGTCGCCCAACGCAGCGCGCTTCTCCGAGGCCCGTTTGGCAGAGGACATGCTACCGCTGGCGTTC
CAGGTCCACGTCATGACGGACTTGGCGCAGAAGCTCTACCACCGGCTGGCGGGACAGGAGCCGCTCAAGTGGGAG
AATAGCCTGAAGGATTACGAGCAGATGCACGGGCGGATCGCGCAGACGGAGGAGTTGCTTTCCAAGGCGAACAAG
GAGGAGGTCAATAAGCATGATGGTGAGACGGTGAGCGTGGGTCTGGGTCCGGGGAAGACGGCGGATATGACGACG
ACGGCTTATGTTAATGGGTATATCTTGCCCAATATCTTCTTTCATTTGACGACGGCGTATGCGATTCTGCGCAAG
GAGGGGGTTCAGTTGGGCAAGATGGATTACTTGAGGCCGTTTATTGGCAAGTATGTCAAGGATGTGTGA
Transcript >Ophcf2|02180
ATGGTCTACACGCTGTACGACGCCTCCATCGCCGTCGCCATCGACGCGCTCGCCTCCCTCACGGCCGTGCTCAAG
AAGGCGCAGGAGTCGCCCAACGCAGCGCGCTTCTCCGAGGCCCGTTTGGCAGAGGACATGCTACCGCTGGCGTTC
CAGGTCCACGTCATGACGGACTTGGCGCAGAAGCTCTACCACCGGCTGGCGGGACAGGAGCCGCTCAAGTGGGAG
AATAGCCTGAAGGATTACGAGCAGATGCACGGGCGGATCGCGCAGACGGAGGAGTTGCTTTCCAAGGCGAACAAG
GAGGAGGTCAATAAGCATGATGGTGAGACGGTGAGCGTGGGTCTGGGTCCGGGGAAGACGGCGGATATGACGACG
ACGGCTTATGTTAATGGGTATATCTTGCCCAATATCTTCTTTCATTTGACGACGGCGTATGCGATTCTGCGCAAG
GAGGGGGTTCAGTTGGGCAAGATGGATTACTTGAGGCCGTTTATTGGCAAGTATGTCAAGGATGTGTGA
Gene >Ophcf2|02180
ATGGTCTACACGCTGTACGACGCCTCCATCGCCGTCGCCATCGACGCGCTCGCCTCCCTCACGGCCGTGCTCAAG
AAGGCGCAGGAGTCGCCCAACGCAGCGCGCTTCTCCGAGGCCCGTTTGGCAGAGGACATGCTACCGCTGGCGTTC
CAGGTCCACGTCATGACGGACTTGGCGCAGAAGCTCTACCACCGGCTGGCGGGACAGGAGCCGCTCAAGTGGGAG
AATAGCCTGAAGGATTACGAGCAGATGCACGGGCGGATCGCGCAGACGGAGGAGTTGCTTTCCAAGGCGAACAAG
GAGGAGGTCAATAAGCATGATGGTGAGACGGTGAGCGTGGGTCTGGGTCCGGGGAAGACGGCGGATATGACGACG
ACGGCTTATGTTAATGGGTATATCTTGCCCAATATCTTCTTTCATTTGACGACGGCGTATGCGATTCTGCGCAAG
GAGGGGGTTCAGTTGGGCAAGATGGATTACTTGAGGCCGTTTATTGGCAAGTATGTCAAGGATGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail