Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02176
Gene name
Locationscaffold_02:2831994..2833504
Strand-
Gene length (bp)1510
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 21.52 10.63 32.40
Alive In ants, during behavior modification 17.06 7.96 26.15
Dead In ants, recently dead 18.06 8.56 27.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.336088 no
Alive Dead 0.820165 no
Dead Fungus 0.469484 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02176
MPNSPAIPPCTGKVPSLRPDIIHNHYYTTNPKALPWYRRKPFFWTAIAVLVFIVVAAAVSLGVVLKLELGKSRMR
VDHQTSSSPPATDQNTSSLQTMQPSQTRTSDTSSGAMSSTAGVSSKSSSPSSTTSTETAAATPSVIFTVSEKSRL
ASVYVEDEQANLHRRFLAWQDDKGHLIVTEWSAGNRSHYRIRDQLRSRIPDAKLGSPLAMAASPSGVVHLFFLDT
QDALSHVFRSATGVWETRTLRKGNGPVIASGPSPLSTAWHRTGDGTEVLAIAYANSQDLRLAMTDGPTAESPWLV
SNVVSLPGPVPGQLQEPCFAVAGDWRNAMGARTMLMAVLMEDGLFAYECPIEMWPPGSKTPCRQLNDTFRDDKDR
DVSFVPPPKQLGWIRLDGHHSAGYDFSLVGLGEDGFISENRIGADEARRAGHGLETRMAARAISATDEAVLFAAA
GDDIYMYRLDVDSGTWRAEGSLQLTSRGRTA*
Coding >Ophcf2|02176
ATGCCAAACTCACCCGCGATCCCGCCTTGTACGGGAAAAGTCCCGTCGCTCCGTCCCGACATCATCCACAACCAC
TATTACACGACGAATCCCAAGGCATTGCCCTGGTACCGTCGCAAGCCTTTCTTCTGGACCGCCATCGCAGTCCTC
GTCTTTATCGTCGTCGCAGCCGCCGTCAGTCTCGGCGTCGTTCTCAAGCTCGAGCTCGGAAAGAGCCGGATGCGC
GTTGACCATCAGACAAGTTCCTCCCCGCCTGCGACGGATCAGAACACGTCGTCTTTGCAGACGATGCAGCCTTCT
CAGACTCGGACATCAGACACGTCTTCTGGTGCTATGTCCTCGACAGCCGGCGTCTCGTCAAAATCCTCGTCGCCA
TCATCGACGACGTCGACCGAAACGGCGGCCGCAACACCCTCAGTCATCTTCACCGTGTCTGAGAAGTCCCGGCTA
GCATCGGTATACGTAGAAGACGAGCAAGCAAATCTCCATCGCCGATTTCTGGCCTGGCAAGATGACAAAGGCCAT
CTCATCGTGACGGAGTGGTCAGCCGGCAACAGAAGCCATTACCGTATCCGCGACCAGCTTCGATCCCGGATCCCA
GACGCCAAGCTCGGCTCGCCACTCGCCATGGCAGCCAGTCCCTCCGGCGTCGTCCACCTCTTCTTTCTCGACACG
CAAGACGCGCTCTCTCACGTCTTCCGCTCTGCCACCGGCGTGTGGGAAACGAGAACGCTGAGAAAAGGCAACGGC
CCGGTAATTGCCTCGGGCCCGTCACCCCTATCGACGGCATGGCATCGCACCGGAGACGGAACCGAGGTTCTAGCC
ATCGCCTACGCAAACTCGCAGGATCTGCGTCTGGCCATGACAGATGGTCCGACAGCCGAGTCTCCTTGGTTGGTC
TCAAACGTGGTGTCTCTTCCGGGTCCTGTTCCCGGGCAGTTGCAGGAGCCTTGCTTTGCCGTGGCCGGAGATTGG
CGTAACGCGATGGGAGCCCGTACAATGCTGATGGCTGTCTTGATGGAAGACGGACTATTCGCGTACGAGTGTCCC
ATTGAGATGTGGCCGCCAGGGTCCAAGACGCCGTGTCGCCAACTCAACGACACGTTCCGAGACGACAAGGACCGA
GACGTCAGTTTCGTGCCGCCCCCGAAGCAGCTCGGTTGGATCCGTCTGGACGGCCATCACAGCGCCGGCTACGAC
TTCAGTCTCGTAGGCCTGGGCGAGGACGGCTTCATCAGCGAGAACAGGATCGGTGCCGACGAGGCGAGGAGAGCT
GGGCACGGGTTGGAGACCCGGATGGCTGCGCGGGCCATTTCGGCGACGGACGAGGCTGTCTTGTTTGCGGCGGCG
GGCGACGACATTTACATGTATCGACTGGACGTCGACAGCGGGACTTGGCGGGCGGAGGGGTCGTTGCAACTGACG
TCTCGTGGCAGGACAGCATGA
Transcript >Ophcf2|02176
ATGCCAAACTCACCCGCGATCCCGCCTTGTACGGGAAAAGTCCCGTCGCTCCGTCCCGACATCATCCACAACCAC
TATTACACGACGAATCCCAAGGCATTGCCCTGGTACCGTCGCAAGCCTTTCTTCTGGACCGCCATCGCAGTCCTC
GTCTTTATCGTCGTCGCAGCCGCCGTCAGTCTCGGCGTCGTTCTCAAGCTCGAGCTCGGAAAGAGCCGGATGCGC
GTTGACCATCAGACAAGTTCCTCCCCGCCTGCGACGGATCAGAACACGTCGTCTTTGCAGACGATGCAGCCTTCT
CAGACTCGGACATCAGACACGTCTTCTGGTGCTATGTCCTCGACAGCCGGCGTCTCGTCAAAATCCTCGTCGCCA
TCATCGACGACGTCGACCGAAACGGCGGCCGCAACACCCTCAGTCATCTTCACCGTGTCTGAGAAGTCCCGGCTA
GCATCGGTATACGTAGAAGACGAGCAAGCAAATCTCCATCGCCGATTTCTGGCCTGGCAAGATGACAAAGGCCAT
CTCATCGTGACGGAGTGGTCAGCCGGCAACAGAAGCCATTACCGTATCCGCGACCAGCTTCGATCCCGGATCCCA
GACGCCAAGCTCGGCTCGCCACTCGCCATGGCAGCCAGTCCCTCCGGCGTCGTCCACCTCTTCTTTCTCGACACG
CAAGACGCGCTCTCTCACGTCTTCCGCTCTGCCACCGGCGTGTGGGAAACGAGAACGCTGAGAAAAGGCAACGGC
CCGGTAATTGCCTCGGGCCCGTCACCCCTATCGACGGCATGGCATCGCACCGGAGACGGAACCGAGGTTCTAGCC
ATCGCCTACGCAAACTCGCAGGATCTGCGTCTGGCCATGACAGATGGTCCGACAGCCGAGTCTCCTTGGTTGGTC
TCAAACGTGGTGTCTCTTCCGGGTCCTGTTCCCGGGCAGTTGCAGGAGCCTTGCTTTGCCGTGGCCGGAGATTGG
CGTAACGCGATGGGAGCCCGTACAATGCTGATGGCTGTCTTGATGGAAGACGGACTATTCGCGTACGAGTGTCCC
ATTGAGATGTGGCCGCCAGGGTCCAAGACGCCGTGTCGCCAACTCAACGACACGTTCCGAGACGACAAGGACCGA
GACGTCAGTTTCGTGCCGCCCCCGAAGCAGCTCGGTTGGATCCGTCTGGACGGCCATCACAGCGCCGGCTACGAC
TTCAGTCTCGTAGGCCTGGGCGAGGACGGCTTCATCAGCGAGAACAGGATCGGTGCCGACGAGGCGAGGAGAGCT
GGGCACGGGTTGGAGACCCGGATGGCTGCGCGGGCCATTTCGGCGACGGACGAGGCTGTCTTGTTTGCGGCGGCG
GGCGACGACATTTACATGTATCGACTGGACGTCGACAGCGGGACTTGGCGGGCGGAGGGGTCGTTGCAACTGACG
TCTCGTGGCAGGACAGCATGA
Gene >Ophcf2|02176
ATGCCAAACTCACCCGCGATCCCGCCTTGTACGGGAAAAGTCCCGTCGCTCCGTCCCGACATCATCCACAACCAC
TATTACACGACGAATCCCAAGGCATTGCCCTGGTACCGTCGCAAGCCTTTCTTCTGGACCGCCATCGCAGTCCTC
GTCTTTATCGTCGTCGCAGCCGCCGTCAGTCTCGGCGTCGTTCTCAAGCTCGAGCTCGGAAAGAGCCGGATGCGC
GTTGACCATCAGACAAGTTCCTCCCCGCCTGCGACGGATCAGAACACGTCGTCTTTGCAGACGATGCAGCCTTCT
CAGACTCGGACATCAGACACGTCTTCTGGTGCTATGTCCTCGACAGCCGGCGTCTCGTCAAAATCCTCGTCGCCA
TCATCGACGACGTCGACCGAAACGGCGGCCGCAACACCCTCAGTCATCTTCACCGTGTCTGAGAAGTCCCGGCTA
GCATCGGTATACGTAGAAGACGAGCAAGCAAATCTCCATCGCCGATTTCTGGCCTGGCAAGATGACAAAGGCCAT
CTCATCGTGACGGAGTGGTCAGCCGGCAACAGAAGCCATTACCGTATCCGCGACCAGCTTCGATCCCGGATCCCA
GACGCCAAGCTCGGCTCGCCACTCGCCATGGCAGCCAGTCCCTCCGGCGTCGTCCACCTCTTCTTTCTCGACACG
CAAGACGCGCTCTCTCACGTCTTCCGCTCTGCCACCGGCGTGTGGGAAACGAGAACGCTGAGAAAAGGCAACGGC
CCGGTAATTGCCTCGGGCCCGTCACCCCTATCGACGGCATGGCATCGCACCGGAGACGGAACCGAGGTTCTAGCC
ATCGCCTACGCAAACTCGCAGGATCTGCGTCTGGCCATGACAGATGGTCCGACAGCCGAGTCTCCTTGGTTGGTC
TCAAACGTGGTGTCTCTTCCGGGTCCTGTTCCCGGGCAGTTGCAGGAGCCTTGCTTTGCCGTGGCCGGAGATTGG
CGTAACGCGATGGGAGCCCGTACAATGCTGATGGCTGTCTTGATGGAAGACGGACTATTCGCGTACGAGTGTCCC
ATTGAGATGTGGCCGCCAGGGTCCAAGACGCCGTGTCGCCAACTCAACGACACGTTCCGAGGTGAACATCTCTTC
TCCTCCCCTTCACCGCTGAATGAACAGCAAGACGCTGACAAGACTTGCAGACGACAAGGACCGAGACGTCAGTTT
CGTGCCGCCCCCGAAGCAGCTCGGTTGGATCCGTCTGGACGGCCATCACAGCGCCGGCTACGACTTCAGTCTCGT
AGGCCTGGGCGAGGACGGCTTCATCAGCGAGAACAGGATCGGTGCCGACGAGGCGAGGAGAGCTGGGCACGGGTT
GGAGACCCGGATGGCTGCGCGGGCCATTTCGGCGACGGACGAGGCTGTCTTGTTTGCGGCGGCGGGCGACGACAT
TTACATGTATCGACTGGACGTCGACAGCGGGACTTGGCGGGCGGAGGGGTCGTTGCAACTGACGTCTCGTGGCAG
GACAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail