Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02174
Gene name
Locationscaffold_02:2827482..2829710
Strand-
Gene length (bp)2228
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05199 GMC_oxred_C GMC oxidoreductase 4.8E-26 515 660
PF00732 GMC_oxred_N GMC oxidoreductase 4.0E-22 131 409

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1621 0.0736 0.9217 0.1032 0.116 0.0919 0.2466 0.2995 0.1465 0.0054

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999008

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 3.0E-83 30 666

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup41
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2518
Ophiocordyceps australis 1348a (Ghana) OphauG2|6397
Ophiocordyceps australis map64 (Brazil) OphauB2|1228
Ophiocordyceps australis map64 (Brazil) OphauB2|1538
Ophiocordyceps camponoti-floridani Ophcf2|01031
Ophiocordyceps camponoti-floridani Ophcf2|02174 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01410
Ophiocordyceps camponoti-rufipedis Ophun1|1472
Ophiocordyceps camponoti-rufipedis Ophun1|1046
Ophiocordyceps camponoti-rufipedis Ophun1|4735
Ophiocordyceps camponoti-rufipedis Ophun1|6088
Ophiocordyceps kimflemingae Ophio5|2180
Ophiocordyceps kimflemingae Ophio5|2725
Ophiocordyceps kimflemingae Ophio5|4485
Ophiocordyceps kimflemingae Ophio5|7497
Ophiocordyceps subramaniannii Hirsu2|8297
Ophiocordyceps subramaniannii Hirsu2|7922
Ophiocordyceps subramaniannii Hirsu2|5937
Ophiocordyceps subramaniannii Hirsu2|4290
Ophiocordyceps subramaniannii Hirsu2|9474
Ophiocordyceps subramaniannii Hirsu2|195

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02174
MMLATALYAALWLCSQAEARFITEVDPKTVYDYIVVGSGAGGSTVGAGLAEAGHSVLIIDAGIDLTATDEYRAPG
YSLKASEFPPMTWEFFVNHYPNLAMQRRDSKMTYLTPSGNRYVGLHPPPFSKPLGVLYPRAGTFGGCTAHNALVT
VYPEESDWDNIAKLTGDNSWNADYMRDIFKKIERCRYVPNSIIGHGFHGWLTTSVASVVFFLEDPKLLAMLHGAA
SALGQGFSKLFENVEGLVQVLHRDLNSGYPNRDRRQGLFQIPIATKQGSRDGPADRVKLLMQGTPGGLFSSAKTY
RLDVLLSSLVTRIILQPPNKPGYAARAVGVEYATGPNLYRADPLSNPNARLPPLRWLQAGREVVLSAGAFNTPQL
LKLSGLGPRQELGRMGIPVIVDLPGVGVNLQDRYEVSVTSASPQPFFLTKLCTFGRTKPDPCLNQWLYGSNDAEK
GAYTSSGLAFAVLKKSTVAEDDIPDLFIAGALANFTGYFLNYDNVATIGARHWTWIILKARTRNRAGTVMLRSRD
PRDTPLINFNYFRSGTNYDGQAEKDALALVEAIDWARAATSNVNNFLHFDQFHEESPGPNVKTTAQEAQWAMDEA
WGHHASCTAAIGADKDPYAVLDSRFRVRGVDGLRVVDASVFPLIPGYYVALSIIMAAQKAAEVMDEDSKTTPPAP
PMPPPMPPPAFSYGNGYSYGGGYRGYGPFGPNHFNHGRGGY*
Coding >Ophcf2|02174
ATGATGCTGGCAACCGCCTTGTACGCAGCCCTCTGGCTGTGCTCTCAGGCCGAAGCACGCTTCATCACAGAAGTA
GACCCCAAAACCGTGTACGATTACATCGTGGTCGGCTCCGGCGCCGGAGGCTCAACCGTAGGCGCCGGCCTCGCC
GAAGCAGGCCACTCCGTCCTCATCATAGACGCGGGCATCGACCTCACAGCAACAGACGAGTACCGCGCGCCAGGA
TACAGTCTAAAGGCGTCAGAGTTCCCGCCCATGACGTGGGAGTTCTTCGTCAACCACTACCCCAACCTGGCGATG
CAGCGTCGCGACTCCAAGATGACGTACCTGACTCCCTCGGGAAACCGCTACGTCGGCCTTCACCCTCCCCCCTTT
TCAAAGCCTCTCGGAGTTCTGTATCCCAGGGCCGGGACTTTCGGTGGCTGTACGGCGCATAACGCGTTGGTGACG
GTCTATCCAGAGGAGTCGGACTGGGACAACATCGCCAAGCTCACGGGCGACAATTCATGGAACGCCGACTACATG
AGGGACATATTCAAGAAGATCGAGCGATGCCGCTACGTTCCCAACTCCATCATAGGACATGGCTTCCACGGCTGG
CTCACAACCAGCGTCGCCAGCGTCGTCTTCTTCCTCGAGGATCCCAAGCTGCTGGCCATGCTGCACGGTGCCGCC
TCCGCCCTCGGCCAGGGCTTCTCCAAGTTGTTCGAGAACGTAGAGGGCCTCGTCCAGGTGCTTCACCGGGATCTC
AACTCGGGATACCCGAACCGAGATCGACGTCAGGGCCTGTTCCAGATCCCCATTGCCACTAAACAAGGAAGCCGA
GACGGCCCCGCGGACCGAGTCAAGTTGCTGATGCAAGGGACGCCGGGGGGCCTCTTCAGCAGCGCCAAGACCTAC
CGTCTCGACGTCCTCCTCAGCTCCCTCGTCACCAGGATCATCCTCCAACCTCCAAACAAGCCCGGATACGCAGCT
CGAGCCGTGGGCGTCGAGTACGCCACGGGCCCGAATCTATACCGCGCCGATCCGCTATCGAACCCCAACGCCAGG
CTCCCCCCCCTCCGCTGGCTCCAGGCCGGAAGGGAGGTCGTCCTCTCGGCCGGAGCCTTCAACACGCCTCAGCTC
CTCAAGCTCAGCGGCCTCGGTCCCCGTCAGGAGCTCGGCCGGATGGGAATCCCCGTCATCGTCGACCTCCCCGGA
GTGGGCGTCAACCTCCAGGACCGCTACGAGGTATCCGTCACGTCCGCCAGCCCGCAGCCCTTCTTCCTCACCAAG
CTGTGCACCTTTGGTCGGACGAAGCCGGATCCGTGCCTGAATCAGTGGCTCTACGGCTCCAACGACGCGGAAAAG
GGCGCCTACACGTCGTCCGGACTGGCCTTTGCGGTGCTCAAGAAGTCGACGGTGGCAGAGGATGATATCCCGGAT
CTGTTCATCGCAGGAGCCCTCGCCAACTTTACGGGATACTTCCTCAACTACGACAACGTGGCCACCATCGGCGCC
CGTCACTGGACGTGGATCATCCTCAAGGCCCGAACTCGGAACCGGGCCGGCACCGTCATGCTCCGATCCCGAGAC
CCTCGAGATACGCCCCTCATCAACTTCAACTACTTCCGGTCCGGCACCAACTACGACGGCCAGGCCGAGAAGGAC
GCACTGGCACTGGTCGAGGCCATCGACTGGGCGCGGGCAGCGACGTCCAACGTGAACAACTTTCTGCACTTTGAC
CAGTTCCACGAGGAGTCACCCGGTCCCAACGTCAAGACGACGGCGCAAGAGGCTCAATGGGCCATGGACGAGGCC
TGGGGTCATCACGCCTCGTGTACGGCCGCCATCGGAGCCGACAAGGACCCTTACGCCGTTCTCGACAGCCGCTTC
CGCGTCCGGGGCGTCGACGGACTCCGCGTCGTCGATGCCAGTGTCTTTCCCCTGATTCCCGGATACTACGTCGCG
CTGTCCATCATCATGGCTGCCCAGAAGGCGGCTGAAGTCATGGATGAGGATTCGAAAACAACGCCCCCTGCGCCG
CCCATGCCGCCTCCGATGCCGCCGCCTGCTTTCTCGTACGGAAACGGGTATAGTTATGGAGGTGGCTATCGCGGT
TACGGGCCCTTTGGCCCGAATCACTTCAATCATGGCCGGGGGGGCTACTGA
Transcript >Ophcf2|02174
ATGATGCTGGCAACCGCCTTGTACGCAGCCCTCTGGCTGTGCTCTCAGGCCGAAGCACGCTTCATCACAGAAGTA
GACCCCAAAACCGTGTACGATTACATCGTGGTCGGCTCCGGCGCCGGAGGCTCAACCGTAGGCGCCGGCCTCGCC
GAAGCAGGCCACTCCGTCCTCATCATAGACGCGGGCATCGACCTCACAGCAACAGACGAGTACCGCGCGCCAGGA
TACAGTCTAAAGGCGTCAGAGTTCCCGCCCATGACGTGGGAGTTCTTCGTCAACCACTACCCCAACCTGGCGATG
CAGCGTCGCGACTCCAAGATGACGTACCTGACTCCCTCGGGAAACCGCTACGTCGGCCTTCACCCTCCCCCCTTT
TCAAAGCCTCTCGGAGTTCTGTATCCCAGGGCCGGGACTTTCGGTGGCTGTACGGCGCATAACGCGTTGGTGACG
GTCTATCCAGAGGAGTCGGACTGGGACAACATCGCCAAGCTCACGGGCGACAATTCATGGAACGCCGACTACATG
AGGGACATATTCAAGAAGATCGAGCGATGCCGCTACGTTCCCAACTCCATCATAGGACATGGCTTCCACGGCTGG
CTCACAACCAGCGTCGCCAGCGTCGTCTTCTTCCTCGAGGATCCCAAGCTGCTGGCCATGCTGCACGGTGCCGCC
TCCGCCCTCGGCCAGGGCTTCTCCAAGTTGTTCGAGAACGTAGAGGGCCTCGTCCAGGTGCTTCACCGGGATCTC
AACTCGGGATACCCGAACCGAGATCGACGTCAGGGCCTGTTCCAGATCCCCATTGCCACTAAACAAGGAAGCCGA
GACGGCCCCGCGGACCGAGTCAAGTTGCTGATGCAAGGGACGCCGGGGGGCCTCTTCAGCAGCGCCAAGACCTAC
CGTCTCGACGTCCTCCTCAGCTCCCTCGTCACCAGGATCATCCTCCAACCTCCAAACAAGCCCGGATACGCAGCT
CGAGCCGTGGGCGTCGAGTACGCCACGGGCCCGAATCTATACCGCGCCGATCCGCTATCGAACCCCAACGCCAGG
CTCCCCCCCCTCCGCTGGCTCCAGGCCGGAAGGGAGGTCGTCCTCTCGGCCGGAGCCTTCAACACGCCTCAGCTC
CTCAAGCTCAGCGGCCTCGGTCCCCGTCAGGAGCTCGGCCGGATGGGAATCCCCGTCATCGTCGACCTCCCCGGA
GTGGGCGTCAACCTCCAGGACCGCTACGAGGTATCCGTCACGTCCGCCAGCCCGCAGCCCTTCTTCCTCACCAAG
CTGTGCACCTTTGGTCGGACGAAGCCGGATCCGTGCCTGAATCAGTGGCTCTACGGCTCCAACGACGCGGAAAAG
GGCGCCTACACGTCGTCCGGACTGGCCTTTGCGGTGCTCAAGAAGTCGACGGTGGCAGAGGATGATATCCCGGAT
CTGTTCATCGCAGGAGCCCTCGCCAACTTTACGGGATACTTCCTCAACTACGACAACGTGGCCACCATCGGCGCC
CGTCACTGGACGTGGATCATCCTCAAGGCCCGAACTCGGAACCGGGCCGGCACCGTCATGCTCCGATCCCGAGAC
CCTCGAGATACGCCCCTCATCAACTTCAACTACTTCCGGTCCGGCACCAACTACGACGGCCAGGCCGAGAAGGAC
GCACTGGCACTGGTCGAGGCCATCGACTGGGCGCGGGCAGCGACGTCCAACGTGAACAACTTTCTGCACTTTGAC
CAGTTCCACGAGGAGTCACCCGGTCCCAACGTCAAGACGACGGCGCAAGAGGCTCAATGGGCCATGGACGAGGCC
TGGGGTCATCACGCCTCGTGTACGGCCGCCATCGGAGCCGACAAGGACCCTTACGCCGTTCTCGACAGCCGCTTC
CGCGTCCGGGGCGTCGACGGACTCCGCGTCGTCGATGCCAGTGTCTTTCCCCTGATTCCCGGATACTACGTCGCG
CTGTCCATCATCATGGCTGCCCAGAAGGCGGCTGAAGTCATGGATGAGGATTCGAAAACAACGCCCCCTGCGCCG
CCCATGCCGCCTCCGATGCCGCCGCCTGCTTTCTCGTACGGAAACGGGTATAGTTATGGAGGTGGCTATCGCGGT
TACGGGCCCTTTGGCCCGAATCACTTCAATCATGGCCGGGGGGGCTACTGA
Gene >Ophcf2|02174
ATGATGCTGGCAACCGCCTTGTACGCAGCCCTCTGGCTGTGCTCTCAGGCCGAAGCGTAAGTCTTCATCTCCGTT
TCCCAACGAACCTCCAATCGACACAGAAGCTGACGAGAAAGACGTCCTAAACCACCAGACGCTTCATCACAGAAG
TAGACCCCAAAACCGTGTACGATTACATCGTGGTCGGCTCCGGCGCCGGAGGCTCAACCGTAGGCGCCGGCCTCG
CCGAAGCAGGCCACTCCGTCCTCATCATAGACGCGGGCATCGACCTCACAGCAACAGACGAGTACCGCGCGCCAG
GATACAGTCTAAAGGCGTCAGAGTTCCCGCCCATGACGTGGGAGTTCTTCGTCAACCACTACCCCAACCTGGCGA
TGCAGCGTCGCGACTCCAAGATGACGTACCTGACTCCCTCGGGAAACCGCTACGTCGGCCTTCACCCTCCCCCCT
TTTCAAAGCCTCTCGGAGTTCTGTATCCCAGGGCCGGGACTTTCGGTGGCTGTACGGCGCATAACGCGTTGGTGA
CGGTCTATCCAGAGGAGTCGGACTGGGACAACATCGCCAAGCTCACGGGCGACAATTCATGGAACGCCGACTACA
TGAGGGACATATTCAAGAAGATCGAGCGATGCCGCTACGTTCCCAACTCCATCATAGGACATGGCTTCCACGGCT
GGCTCACAACCAGCGTCGCCAGCGTCGTCTTCTTCCTCGAGGATCCCAAGCTGCTGGCCATGCTGCACGGTGCCG
CCTCCGCCCTCGGCCAGGGCTTCTCCAAGTTGTTCGAGAACGTAGAGGGCCTCGTCCAGGTGCTTCACCGGGATC
TCAACTCGGGATACCCGAACCGAGATCGACGTCAGGGCCTGTTCCAGATCCCCATTGCCACTAAACAAGGAAGCC
GAGACGGCCCCGCGGACCGAGTCAAGTTGCTGATGCAAGGGACGCCGGGGGGCCTCTTCAGCAGCGCCAAGACCT
ACCGTCTCGACGTCCTCCTCAGCTCCCTCGTCACCAGGATCATCCTCCAACCTCCAAACAAGCCCGGATACGCAG
CTCGAGCCGTGGGCGTCGAGTACGCCACGGGCCCGAATCTATACCGCGCCGATCCGCTATCGAACCCCAACGCCA
GGCTCCCCCCCCTCCGCTGGCTCCAGGCCGGAAGGGAGGTCGTCCTCTCGGCCGGAGCCTTCAACACGCCTCAGC
TCCTCAAGCTCAGCGGCCTCGGTCCCCGTCAGGAGCTCGGCCGGATGGGAATCCCCGTCATCGTCGACCTCCCCG
GAGTGGGCGTCAACCTCCAGGACCGCTACGAGGTATCCGTCACGTCCGCCAGCCCGCAGCCCTTCTTCCTCACCA
AGCTGTGCACCTTTGGTCGGACGAAGCCGGATCCGTGCCTGAATCAGTGGCTCTACGGCTCCAACGACGCGGAAA
AGGGCGCCTACACGTCGTCCGGACTGGCCTTTGCGGTGCTCAAGAAGTCGACGGTGGCAGAGGATGATATCCCGG
ATCTGTTCATCGCAGGAGCCCTCGCCAACTTTACGGGATACTTCCTCAACTACGACAACGTGGCCACCATCGGCG
CCCGTCACTGGACGTGGATCATCCTCAAGGCCCGAACTCGGAACCGGGCCGGCACCGTCATGCTCCGATCCCGAG
ACCCTCGAGATACGCCCCTCATCAACTTCAACTACTTCCGGTCCGGCACCAACTACGACGGCCAGGCCGAGAAGG
ACGCACTGGCACTGGTCGAGGCCATCGACTGGGCGCGGGCAGCGACGTCCAACGTGAACAACTTTCTGCACTTTG
ACCAGTTCCACGAGGAGTCACCCGGTCCCAACGTCAAGACGACGGCGCAAGAGGCTCAATGGGCCATGGACGAGG
CCTGGGGTCATCACGCCTCGTGTACGGCCGCCATCGGAGCCGACAAGGACCCTTACGCCGTTCTCGACAGCCGCT
TCCGCGTCCGGGGCGTCGACGGACTCCGCGTCGTCGATGCCAGTGTCTTTCCCCTGATTCCCGGATACTACGTCG
CGCTGTCCATCATCATGGCTGCCCAGAAGGCGGCTGAAGTCATGGATGAGGATTCGAAAACAACGCCCCCTGCGC
CGCCCATGCCGCCTCCGATGCCGCCGCCTGCTTTCTCGTACGGAAACGGGTATAGTTATGGAGGTGGCTATCGCG
GTTACGGGCCCTTTGGCCCGAATCACTTCAATCATGGCCGGGGGGGCTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail