Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02164
Gene name
Locationscaffold_02:2804881..2805951
Strand-
Gene length (bp)1070
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 1.7E-33 44 286

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 75 22
3 96 118 22
4 155 177 22
5 189 211 22
6 231 253 22
7 260 279 19
8 294 311 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.07 0.00 0.25
Alive In ants, during behavior modification 904.24 279.92 1528.55
Dead In ants, recently dead 99.83 50.01 149.65

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.378720 no
Alive Dead 0.000238 yes
Dead Fungus 0.378720 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02164
MPTSKRHMTRHLFTLSRFNKYNPLFTTFAGAWSALLAGAADLASQRPTVTPLFVLRQTGLCFVAAYLSCGAGMVW
NDWVDRDIDANVSRTRDRPLAAGIVTTGEAMAWMLLQLLLSWLVLHVMLQGKDVWKHLLPIMIASFLYPFGKRPL
ARTLYIYPQYILAFVIAWPAVPGRAAISGRHDAFSHTMLHCLPICTTVFFWTLYLNTAYSYQDVVDDRKLNVNSL
YNVAGRHTHGLLVALVSPILLCLPLHLAQFRSPWLWISWMGVWTAALATQLLRFDPKRPSSGGTLHKSNFVLGVW
TIVACVVEVLLKT*
Coding >Ophcf2|02164
ATGCCAACATCAAAGAGACACATGACGCGCCACCTCTTCACCCTCTCGCGCTTCAACAAGTACAACCCTCTCTTC
ACCACTTTCGCCGGAGCATGGTCCGCGCTACTGGCCGGAGCGGCAGACCTGGCCTCCCAGCGGCCGACGGTGACG
CCTCTGTTCGTCCTCAGGCAGACGGGCCTCTGCTTCGTAGCGGCCTACCTGTCCTGCGGCGCCGGCATGGTGTGG
AACGACTGGGTTGATCGCGATATCGATGCCAATGTTTCTCGGACGAGGGATCGACCGCTGGCTGCGGGAATCGTC
ACGACGGGTGAGGCTATGGCGTGGATGCTGCTTCAGCTCTTGCTGTCGTGGCTGGTGCTTCATGTCATGCTCCAA
GGAAAAGACGTATGGAAGCACCTGCTGCCCATCATGATAGCCTCATTCCTCTATCCCTTCGGAAAGAGACCGCTG
GCGAGGACGCTCTACATCTACCCGCAGTACATCCTAGCCTTCGTCATCGCCTGGCCTGCCGTCCCCGGAAGGGCC
GCCATCTCAGGTCGTCACGACGCCTTCTCCCACACGATGCTCCACTGCCTCCCCATCTGCACCACCGTCTTCTTC
TGGACCCTGTACCTCAACACAGCCTACAGCTACCAAGACGTCGTCGACGACCGAAAGCTCAACGTCAACTCGCTG
TACAACGTCGCCGGACGACACACGCACGGCCTGCTCGTCGCCCTCGTCAGCCCCATCCTGCTGTGTCTGCCTCTA
CACCTGGCTCAGTTTCGGTCCCCTTGGCTGTGGATCAGCTGGATGGGCGTCTGGACCGCGGCTCTGGCGACGCAG
TTGCTGCGCTTTGACCCGAAGCGGCCTTCGAGCGGAGGGACGCTGCATAAGAGCAACTTTGTTCTCGGTGTCTGG
ACTATTGTTGCGTGTGTGGTCGAGGTGTTGTTGAAGACATGA
Transcript >Ophcf2|02164
ATGCCAACATCAAAGAGACACATGACGCGCCACCTCTTCACCCTCTCGCGCTTCAACAAGTACAACCCTCTCTTC
ACCACTTTCGCCGGAGCATGGTCCGCGCTACTGGCCGGAGCGGCAGACCTGGCCTCCCAGCGGCCGACGGTGACG
CCTCTGTTCGTCCTCAGGCAGACGGGCCTCTGCTTCGTAGCGGCCTACCTGTCCTGCGGCGCCGGCATGGTGTGG
AACGACTGGGTTGATCGCGATATCGATGCCAATGTTTCTCGGACGAGGGATCGACCGCTGGCTGCGGGAATCGTC
ACGACGGGTGAGGCTATGGCGTGGATGCTGCTTCAGCTCTTGCTGTCGTGGCTGGTGCTTCATGTCATGCTCCAA
GGAAAAGACGTATGGAAGCACCTGCTGCCCATCATGATAGCCTCATTCCTCTATCCCTTCGGAAAGAGACCGCTG
GCGAGGACGCTCTACATCTACCCGCAGTACATCCTAGCCTTCGTCATCGCCTGGCCTGCCGTCCCCGGAAGGGCC
GCCATCTCAGGTCGTCACGACGCCTTCTCCCACACGATGCTCCACTGCCTCCCCATCTGCACCACCGTCTTCTTC
TGGACCCTGTACCTCAACACAGCCTACAGCTACCAAGACGTCGTCGACGACCGAAAGCTCAACGTCAACTCGCTG
TACAACGTCGCCGGACGACACACGCACGGCCTGCTCGTCGCCCTCGTCAGCCCCATCCTGCTGTGTCTGCCTCTA
CACCTGGCTCAGTTTCGGTCCCCTTGGCTGTGGATCAGCTGGATGGGCGTCTGGACCGCGGCTCTGGCGACGCAG
TTGCTGCGCTTTGACCCGAAGCGGCCTTCGAGCGGAGGGACGCTGCATAAGAGCAACTTTGTTCTCGGTGTCTGG
ACTATTGTTGCGTGTGTGGTCGAGGTGTTGTTGAAGACATGA
Gene >Ophcf2|02164
ATGCCAACATCAAAGAGACACATGACGCGCCACCTCTTCACCCTCTCGCGCTTCAACAAGTACAACCCTCTCTTC
ACCACTTTCGCCGGAGGTACGTGACCTCACAAATCAACAAACCAGCTCGCCCTTACCAAACTCACCGACAAGCAC
AAAAAGCATGGTCCGCGCTACTGGCCGGAGCGGCAGACCTGGCCTCCCAGCGGCCGACGGTGACGCCTCTGTTCG
TCCTCAGGCAGACGGGCCTCTGCTTCGTAGCGGCCTACCTGTCCTGCGGCGCCGGCATGGTGTGGAACGACTGGG
TTGATCGCGATATCGATGCCAATGTTTCTCGGACGAGGGATCGACCGCTGGCTGCGGGAATCGTCACGACGGGTG
AGGCTATGGCGTGGATGCTGCTTCAGCTCTTGCTGTCGTGGCTGGTGCTTCATGTCATGCTCCAAGGAAAAGACG
TGTAAGTCTCGTTCGTCAAGTCACCACGTCGATGCCGTCCATCGAACCTCTCACACTCGCACAGATGGAAGCACC
TGCTGCCCATCATGATAGCCTCATTCCTCTATCCCTTCGGAAAGAGACCGCTGGCGAGGACGCTCTACATCTACC
CGCAGTACATCCTAGCCTTCGTCATCGCCTGGCCTGCCGTCCCCGGAAGGGCCGCCATCTCAGGTCGTCACGACG
CCTTCTCCCACACGATGCTCCACTGCCTCCCCATCTGCACCACCGTCTTCTTCTGGACCCTGTACCTCAACACAG
CCTACAGCTACCAAGACGTCGTCGACGACCGAAAGCTCAACGTCAACTCGCTGTACAACGTCGCCGGACGACACA
CGCACGGCCTGCTCGTCGCCCTCGTCAGCCCCATCCTGCTGTGTCTGCCTCTACACCTGGCTCAGTTTCGGTCCC
CTTGGCTGTGGATCAGCTGGATGGGCGTCTGGACCGCGGCTCTGGCGACGCAGTTGCTGCGCTTTGACCCGAAGC
GGCCTTCGAGCGGAGGGACGCTGCATAAGAGCAACTTTGTTCTCGGTGTCTGGACTATTGTTGCGTGTGTGGTCG
AGGTGTTGTTGAAGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail