Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02157
Gene name
Locationscaffold_02:2781815..2783824
Strand+
Gene length (bp)2009
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11712 Vma12 Endoplasmic reticulum-based factor for assembly of V-ATPase 3.6E-42 67 209

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 152 171 19
2 181 203 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 22.95 10.52 35.38
Alive In ants, during behavior modification 22.36 10.03 34.69
Dead In ants, recently dead 17.44 7.39 27.49

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.930105 no
Alive Dead 0.271647 no
Dead Fungus 0.280490 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02157
MVLLTMTPPMVEGLDSLRTADGNEDDVGSEPSLAQPAVGKPISHAQVVHLWTALQSSQLSPCSLERLLRGSRVFV
PPPPPKPEPSEEYKALMARLRREEAARAYQRMVSPTPPTESFYDRFPTAAVNRPTHASDLGDEDDVSYAEVQRQV
MLIINFLVSILGVAGTLWVAARYWSLPARLLLALSGAIVVAVAETAVYRVYLWRKGQARAKQKAVVETQEVVNTP
TEENHAGDRVQIPSDSDDTEKRCSAAPCADGHCVTQLAETERSAKPGGETKRRRRPRVQTTLNLSTGGTFAECKI
CNTVWNPLFPDDVSYHTRRHAKVTARARRKKDDYL*
Coding >Ophcf2|02157
ATGGTGCTCCTCACCATGACGCCGCCCATGGTTGAGGGCCTGGACAGCCTGAGAACGGCTGATGGCAACGAAGAT
GACGTTGGCTCCGAGCCCTCGCTTGCCCAGCCTGCAGTCGGCAAGCCAATATCTCACGCCCAGGTGGTCCATCTC
TGGACAGCTCTTCAGTCATCGCAGCTTTCTCCCTGCAGTCTGGAAAGACTCCTCCGGGGCTCTCGCGTCTTTGTG
CCGCCGCCGCCGCCAAAGCCCGAGCCCTCGGAAGAATACAAGGCGCTCATGGCCCGCCTTCGCCGAGAAGAGGCC
GCCCGCGCTTACCAGCGAATGGTCAGTCCGACTCCGCCGACCGAGAGCTTCTACGACCGCTTCCCGACCGCTGCG
GTGAACCGTCCGACACACGCGTCCGATCTGGGAGACGAGGACGACGTGTCGTACGCAGAGGTGCAGCGACAGGTC
ATGCTCATCATCAACTTTCTCGTGAGTATCCTGGGCGTCGCGGGGACCTTGTGGGTGGCGGCGCGATACTGGAGT
CTCCCTGCGCGGCTGCTTCTCGCCCTGAGTGGCGCCATCGTCGTCGCCGTAGCCGAGACGGCCGTATACCGCGTC
TATCTGTGGAGGAAGGGCCAGGCCAGGGCCAAGCAAAAAGCCGTGGTCGAGACTCAGGAAGTGGTCAATACCCCG
ACGGAAGAAAACCACGCCGGAGACCGCGTCCAAATCCCCAGCGACTCAGACGACACCGAAAAGCGGTGCAGCGCG
GCTCCCTGCGCGGACGGACACTGCGTCACCCAACTGGCCGAGACAGAGCGCAGCGCGAAGCCAGGAGGCGAGACC
AAGCGGAGACGCAGGCCGCGCGTACAGACGACGCTGAACTTGTCGACGGGGGGGACTTTTGCAGAGTGCAAGATC
TGCAATACGGTTTGGAATCCTCTGTTTCCGGACGATGTCAGCTACCACACGCGGCGTCACGCCAAGGTGACGGCG
AGGGCGAGGAGAAAGAAAGACGATTATCTTTAG
Transcript >Ophcf2|02157
ATGGTGCTCCTCACCATGACGCCGCCCATGGTTGAGGGCCTGGACAGCCTGAGAACGGCTGATGGCAACGAAGAT
GACGTTGGCTCCGAGCCCTCGCTTGCCCAGCCTGCAGTCGGCAAGCCAATATCTCACGCCCAGGTGGTCCATCTC
TGGACAGCTCTTCAGTCATCGCAGCTTTCTCCCTGCAGTCTGGAAAGACTCCTCCGGGGCTCTCGCGTCTTTGTG
CCGCCGCCGCCGCCAAAGCCCGAGCCCTCGGAAGAATACAAGGCGCTCATGGCCCGCCTTCGCCGAGAAGAGGCC
GCCCGCGCTTACCAGCGAATGGTCAGTCCGACTCCGCCGACCGAGAGCTTCTACGACCGCTTCCCGACCGCTGCG
GTGAACCGTCCGACACACGCGTCCGATCTGGGAGACGAGGACGACGTGTCGTACGCAGAGGTGCAGCGACAGGTC
ATGCTCATCATCAACTTTCTCGTGAGTATCCTGGGCGTCGCGGGGACCTTGTGGGTGGCGGCGCGATACTGGAGT
CTCCCTGCGCGGCTGCTTCTCGCCCTGAGTGGCGCCATCGTCGTCGCCGTAGCCGAGACGGCCGTATACCGCGTC
TATCTGTGGAGGAAGGGCCAGGCCAGGGCCAAGCAAAAAGCCGTGGTCGAGACTCAGGAAGTGGTCAATACCCCG
ACGGAAGAAAACCACGCCGGAGACCGCGTCCAAATCCCCAGCGACTCAGACGACACCGAAAAGCGGTGCAGCGCG
GCTCCCTGCGCGGACGGACACTGCGTCACCCAACTGGCCGAGACAGAGCGCAGCGCGAAGCCAGGAGGCGAGACC
AAGCGGAGACGCAGGCCGCGCGTACAGACGACGCTGAACTTGTCGACGGGGGGGACTTTTGCAGAGTGCAAGATC
TGCAATACGGTTTGGAATCCTCTGTTTCCGGACGATGTCAGCTACCACACGCGGCGTCACGCCAAGGTGACGGCG
AGGGCGAGGAGAAAGAAAGACGATTATCTTTAG
Gene >Ophcf2|02157
ATGGTGCTCCTCACCATGACGCCGCCCATGGTTGAGGGCCTGGACAGCCTGAGAACGGCTGATGGCAACGAAGAT
GACGTTGGCTCCGAGCCCTCGCTTGCCCAGCCTGCAGTCGGCAAGCCAATATCTCACGCCCAGGTGGTCCATCTC
TGGACAGCTCTTCAGTCATCGCAGCTTTCTCCCTGCAGTCTGGAAAGACTCCTCCGGGGCTCTCGCGTCTTTGTG
CCGCCGCCGCCGCCAAAGCCCGAGCCCGTCCGTCATGTCCTCTCCTCTGCGTCAGACGAGCACTGACCCACTGCA
GTCGGAAGAATACAAGGCGCTCATGGCCCGCCTTCGCCGAGAAGAGGCCGCCCGCGCTTACCAGCGAATGGTCAG
TCCGACTCCGCCGACCGAGAGCTTCTACGACCGCTTCCCGACCGCTGCGGTGAACCGTCCGACACACGCGTCCGA
TCTGGGAGACGAGGACGACGTGTCGTACGCAGAGGTGCAGCGACAGGTCATGCTCATCATCAACTTTCTCGTGAG
TATCCTGGGCGTCGCGGGGACCTTGTGGGTGGCGGCGCGATACTGGAGTCTCCCTGCGCGGCTGCTTCTCGCCCT
GAGTGGCGCCATCGTCGTCGCCGTAGCCGAGACGGCCGTATACCGCGTCTATCTGTGGAGGAAGGGCCAGGCCAG
GGCCAAGCAAAAAGCCGTGGTCGAGACTCAGGAAGTGGTCAATACGTGGGTGGTCGGGAAAGATGCCTGCCAAGA
CGACGACTCGTCTGTTCTTCTGCCAGCCAGACAGGATGACATGGATAGTACGGCCCGGAGGCGAAGACCAGCGGC
GACTGAGCCTTTGGAGGCAGAGGTGAAAGGAGCTTGAGTATTTGTTTTCGCGTAGGCGCCGCCATTGTACGACCT
GGCCGTGATTTTCTGGCTGTCACCAGCATCGTAGACATGTCTGTCGTATGTATTCGTTGGCGCTAAAAGAGGAGC
AAGGGCCGCTCAGCGATGCCGTCTCTGACAACGTTTACACATGGTGTACGGATATGATGTAAAGTATGTACAAAT
AAGACACACTCACTTCGCACATCGAGCGTCATGTGATCGCGCGTCGCGTTTTTCTCAGTCTATTCGCACGCGTGA
CTTGGTTTTCGCAACACCTCTTTCGCGATAAGCTCTGGACAGCACAAGATTCGTGGAAAGACTCTCTTCAAACAA
GCCGAGCCGTAAACGGCCGAAAGACGGCAAACAATACGAATCTCTCTTTAACCGCATTCTGGCCTGGCAGGACGA
AGCAAATCATGTCTAGCTTCCCGTCTCGAAGACGCGACGGGCCTTTGCGCACCTATGGCAAGCGATCAGCCTCTT
CCAATGCGCCAGGACAGCCCTCTCCCAAGAGACAGATTATCGAAGCGAAGGAAAATAAATCTCTTGACGCGGGTG
CCACCTCGATCACGAAACCTGGTCCTGCTTCCGGCGTCGCGCATGTCACATACCAACCGGCTCAAGCCAACGGGA
AGCTGTCGACACGTCCGTCGATTCGCGCATACTTTAAGCCGGTGCTGCGTGCGAAGGTCGACGACTTGCCGAAGC
CGGACTCTTCTGACGAACCGTCTGGCTCTCTTCGCTCGACTTACGCGCACGAAAGAAGACGACCGCGTCTACTCA
GGCTTCGACCGACGACATCCAGCCCGACGGAAGAAAACCACGCCGGAGACCGCGTCCAAATCCCCAGCGACTCAG
ACGACACCGAAAAGCGGTGCAGCGCGGCTCCCTGCGCGGACGGACACTGCGTCACCCAACTGGCCGAGACAGAGC
GCAGCGCGAAGCCAGGAGGCGAGACCAAGCGGAGACGCAGGCCGCGCGTACAGACGACGCTGAACTTGTCGACGG
GGGGGACTTTTGCAGAGTGCAAGATCTGCAATACGGTTTGGAATCCTCTGTTTCCGGACGATGTCAGCTACCACA
CGCGGCGTCACGCCAAGGTGACGGCGAGGGCGAGGAGAAAGAAAGACGATTATCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail