Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02152
Gene name
Locationscaffold_02:2773298..2774924
Strand+
Gene length (bp)1626
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 1.8E-10 106 334
PF07690 MFS_1 Major Facilitator Superfamily 5.8E-09 90 386

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 100 122 22
3 152 174 22
4 187 209 22
5 219 241 22
6 277 299 22
7 319 341 22
8 348 370 22
9 395 417 22
10 458 480 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02152
MAPWRNRDSFPSFTAVKRPVSGIQDLHVETVNRVGVGRDGSPWEVAGRAKSSLCQLRGHPWTQILLISLICFCLP
GMYNALTGLGGCGQVDATVAANATVALLSTMAITSLFIAGPLFAWAGPRISLMAGGWTYALYSGSLLNFNRTGNG
ALVIASGAMLGVGASLLWIVQGAIMTSYVDESRKGRAIAIFWVVFNLGGGIGSLASFGLNYNSGKGSVSSSTYVA
LMIVMLFGWSLALLLCSPERVRGTMTTASTPKAARPWHRIIIDVVRSSSRVLCTWRVACMLPLFFSANVFYSYQQ
NSVNGDTFNIHTRSLNGAFYWLAQMVGGLFIGLILDLPCLGRRGRARLGWAIAFVFGLIIWGGGYQFQLWQNDRL
ASGQRQDVDFKDSALAAGPMALYTFYGAYDALWQAFAYWLIGTESNNPTRAAILVGAYKGLQAAGGSIAWRVNAF
SVSPMTELAMNWGLCIGSLLVVLPVVWTVSASTDDEGEQPEKGADEGLKGDDTQV*
Coding >Ophcf2|02152
ATGGCTCCGTGGCGGAACCGAGATAGCTTCCCGTCTTTCACGGCGGTTAAGAGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGTGTTGGCGTCGGTCGTGACGGGTCGCCATGGGAGGTTGCCGGTAGAGCCAAG
TCGAGTCTTTGCCAGCTTCGCGGCCATCCGTGGACGCAGATCCTGCTCATCAGTCTGATATGCTTCTGTCTCCCC
GGCATGTACAACGCCCTAACCGGCCTCGGAGGCTGCGGCCAAGTCGACGCAACAGTAGCAGCCAACGCAACAGTA
GCCCTCCTCTCAACCATGGCCATAACCTCTCTCTTCATAGCCGGTCCGCTCTTCGCCTGGGCCGGCCCACGCATC
AGCCTCATGGCCGGCGGTTGGACCTACGCTCTCTACAGCGGAAGCCTCCTCAACTTCAACCGTACCGGAAACGGC
GCCCTCGTCATCGCATCGGGCGCCATGCTCGGCGTCGGCGCCTCGCTTCTATGGATCGTTCAGGGGGCCATCATG
ACGTCTTACGTCGATGAGTCGCGCAAGGGCCGCGCCATCGCCATCTTCTGGGTTGTCTTTAACCTCGGAGGCGGC
ATCGGCTCTCTCGCCTCCTTCGGCCTCAACTATAACTCGGGCAAGGGCTCCGTCTCGAGCTCAACATACGTCGCC
CTCATGATCGTCATGCTCTTCGGCTGGTCTCTAGCCCTACTACTGTGCTCGCCCGAACGAGTCCGCGGGACGATG
ACTACGGCCTCAACCCCGAAAGCTGCCCGGCCTTGGCACCGGATCATCATCGACGTCGTCCGGAGCTCATCCCGG
GTTCTCTGCACCTGGCGTGTCGCCTGCATGCTTCCTCTCTTCTTCTCCGCCAACGTCTTCTACAGCTATCAGCAA
AACAGCGTCAACGGCGACACCTTCAACATCCACACCCGCTCCCTCAACGGCGCCTTCTACTGGCTGGCCCAGATG
GTAGGCGGCCTGTTCATCGGCCTCATCCTCGACCTACCCTGTCTCGGACGTCGTGGCCGCGCCCGCCTCGGCTGG
GCCATCGCCTTCGTCTTCGGACTCATCATCTGGGGCGGCGGATATCAGTTCCAGCTCTGGCAGAACGACCGACTA
GCCAGTGGTCAGCGTCAGGACGTAGACTTCAAGGACAGCGCCCTGGCGGCGGGTCCCATGGCCCTCTACACCTTC
TACGGCGCCTACGATGCCCTCTGGCAGGCCTTTGCCTACTGGCTCATCGGCACCGAGTCCAACAACCCTACCCGC
GCCGCCATCCTCGTCGGCGCCTATAAGGGATTGCAGGCCGCGGGCGGGAGCATTGCCTGGCGCGTCAACGCATTC
AGCGTGAGTCCAATGACGGAGCTGGCCATGAACTGGGGGCTCTGCATCGGCTCCCTGCTCGTCGTCCTTCCCGTC
GTCTGGACCGTTTCCGCGAGCACCGACGACGAGGGCGAACAGCCGGAAAAGGGGGCAGATGAAGGATTGAAGGGT
GACGACACGCAGGTGTAG
Transcript >Ophcf2|02152
ATGGCTCCGTGGCGGAACCGAGATAGCTTCCCGTCTTTCACGGCGGTTAAGAGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGTGTTGGCGTCGGTCGTGACGGGTCGCCATGGGAGGTTGCCGGTAGAGCCAAG
TCGAGTCTTTGCCAGCTTCGCGGCCATCCGTGGACGCAGATCCTGCTCATCAGTCTGATATGCTTCTGTCTCCCC
GGCATGTACAACGCCCTAACCGGCCTCGGAGGCTGCGGCCAAGTCGACGCAACAGTAGCAGCCAACGCAACAGTA
GCCCTCCTCTCAACCATGGCCATAACCTCTCTCTTCATAGCCGGTCCGCTCTTCGCCTGGGCCGGCCCACGCATC
AGCCTCATGGCCGGCGGTTGGACCTACGCTCTCTACAGCGGAAGCCTCCTCAACTTCAACCGTACCGGAAACGGC
GCCCTCGTCATCGCATCGGGCGCCATGCTCGGCGTCGGCGCCTCGCTTCTATGGATCGTTCAGGGGGCCATCATG
ACGTCTTACGTCGATGAGTCGCGCAAGGGCCGCGCCATCGCCATCTTCTGGGTTGTCTTTAACCTCGGAGGCGGC
ATCGGCTCTCTCGCCTCCTTCGGCCTCAACTATAACTCGGGCAAGGGCTCCGTCTCGAGCTCAACATACGTCGCC
CTCATGATCGTCATGCTCTTCGGCTGGTCTCTAGCCCTACTACTGTGCTCGCCCGAACGAGTCCGCGGGACGATG
ACTACGGCCTCAACCCCGAAAGCTGCCCGGCCTTGGCACCGGATCATCATCGACGTCGTCCGGAGCTCATCCCGG
GTTCTCTGCACCTGGCGTGTCGCCTGCATGCTTCCTCTCTTCTTCTCCGCCAACGTCTTCTACAGCTATCAGCAA
AACAGCGTCAACGGCGACACCTTCAACATCCACACCCGCTCCCTCAACGGCGCCTTCTACTGGCTGGCCCAGATG
GTAGGCGGCCTGTTCATCGGCCTCATCCTCGACCTACCCTGTCTCGGACGTCGTGGCCGCGCCCGCCTCGGCTGG
GCCATCGCCTTCGTCTTCGGACTCATCATCTGGGGCGGCGGATATCAGTTCCAGCTCTGGCAGAACGACCGACTA
GCCAGTGGTCAGCGTCAGGACGTAGACTTCAAGGACAGCGCCCTGGCGGCGGGTCCCATGGCCCTCTACACCTTC
TACGGCGCCTACGATGCCCTCTGGCAGGCCTTTGCCTACTGGCTCATCGGCACCGAGTCCAACAACCCTACCCGC
GCCGCCATCCTCGTCGGCGCCTATAAGGGATTGCAGGCCGCGGGCGGGAGCATTGCCTGGCGCGTCAACGCATTC
AGCGTGAGTCCAATGACGGAGCTGGCCATGAACTGGGGGCTCTGCATCGGCTCCCTGCTCGTCGTCCTTCCCGTC
GTCTGGACCGTTTCCGCGAGCACCGACGACGAGGGCGAACAGCCGGAAAAGGGGGCAGATGAAGGATTGAAGGGT
GACGACACGCAGGTGTAG
Gene >Ophcf2|02152
ATGGCTCCGTGGCGGAACCGAGATAGCTTCCCGTCTTTCACGGCGGTTAAGAGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGTGTTGGCGTCGGTCGTGACGGGTCGCCATGGGAGGTTGCCGGTAGAGCCAAG
TCGAGTCTTTGCCAGCTTCGCGGCCATCCGTGGACGCAGATCCTGCTCATCAGTCTGATATGCTTCTGTCTCCCC
GGCGTACGTGTTTCCCCATCTTCCATTCTCCTAGTTCCTGCTCTCACCCGTCTGATACCCTCTTTCCCCTTCCCC
CATCTCCAACTCAACCCATCATCTAACAAGCAACAGATGTACAACGCCCTAACCGGCCTCGGAGGCTGCGGCCAA
GTCGACGCAACAGTAGCAGCCAACGCAACAGTAGCCCTCCTCTCAACCATGGCCATAACCTCTCTCTTCATAGCC
GGTCCGCTCTTCGCCTGGGCCGGCCCACGCATCAGCCTCATGGCCGGCGGTTGGACCTACGCTCTCTACAGCGGA
AGCCTCCTCAACTTCAACCGTACCGGAAACGGCGCCCTCGTCATCGCATCGGGCGCCATGCTCGGCGTCGGCGCC
TCGCTTCTATGGATCGTTCAGGGGGCCATCATGACGTCTTACGTCGATGAGTCGCGCAAGGGCCGCGCCATCGCC
ATCTTCTGGGTTGTCTTTAACCTCGGAGGCGGCATCGGCTCTCTCGCCTCCTTCGGCCTCAACTATAACTCGGGC
AAGGGCTCCGTCTCGAGCTCAACATACGTCGCCCTCATGATCGTCATGCTCTTCGGCTGGTCTCTAGCCCTACTA
CTGTGCTCGCCCGAACGAGTCCGCGGGACGATGACTACGGCCTCAACCCCGAAAGCTGCCCGGCCTTGGCACCGG
ATCATCATCGACGTCGTCCGGAGCTCATCCCGGGTTCTCTGCACCTGGCGTGTCGCCTGCATGCTTCCTCTCTTC
TTCTCCGCCAACGTCTTCTACAGCTATCAGCAAAACAGCGTCAACGGCGACACCTTCAACATCCACACCCGCTCC
CTCAACGGCGCCTTCTACTGGCTGGCCCAGATGGTAGGCGGCCTGTTCATCGGCCTCATCCTCGACCTACCCTGT
CTCGGACGTCGTGGCCGCGCCCGCCTCGGCTGGGCCATCGCCTTCGTCTTCGGACTCATCATCTGGGGCGGCGGA
TATCAGTTCCAGCTCTGGCAGAACGACCGACTAGCCAGTGGTCAGCGTCAGGACGTAGACTTCAAGGACAGCGCC
CTGGCGGCGGGTCCCATGGCCCTCTACACCTTCTACGGCGCCTACGATGCCCTCTGGCAGGCCTTTGCCTACTGG
CTCATCGGCACCGAGTCCAACAACCCTACCCGCGCCGCCATCCTCGTCGGCGCCTATAAGGGATTGCAGGCCGCG
GGCGGGAGCATTGCCTGGCGCGTCAACGCATTCAGCGTGAGTCCAATGACGGAGCTGGCCATGAACTGGGGGCTC
TGCATCGGCTCCCTGCTCGTCGTCCTTCCCGTCGTCTGGACCGTTTCCGCGAGCACCGACGACGAGGGCGAACAG
CCGGAAAAGGGGGCAGATGAAGGATTGAAGGGTGACGACACGCAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail