Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02151
Gene name
Locationscaffold_02:2770035..2770693
Strand+
Gene length (bp)658
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13934 ELYS Nuclear pore complex assembly 8.9E-40 40 159

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.544 0.5534 0.0438 0.1071 0.1534 0.0016 0.1284 0.2628 0.4379 0.0053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2703
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3718
Ophiocordyceps australis map64 (Brazil) OphauB2|6690
Ophiocordyceps camponoti-floridani Ophcf2|02151 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6887
Ophiocordyceps kimflemingae Ophio5|5936
Ophiocordyceps subramaniannii Hirsu2|4215

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02151
MAAMEGVTDFERVFPSSLKFPYDRTLQHEIEHHRKAVGGTLFIDRVMTTLGLVKGRTYPPKSENALRQLHQLFCD
SNMSVQHKQSLIYYILLDFDTESSQSSTSDTFAADAGMPVNYQIFMRGLWLMDRQQFKEALKFVAHPSLKPDFAD
EIIITLVHRL*
Coding >Ophcf2|02151
ATGGCTGCGATGGAAGGCGTCACAGACTTTGAACGAGTCTTCCCCAGCAGCTTGAAATTCCCTTACGATCGCACC
CTTCAGCATGAGATTGAGCATCATCGCAAGGCAGTGGGCGGCACTCTCTTCATCGACCGCGTCATGACCACTCTT
GGTCTTGTCAAAGGCCGAACCTATCCTCCCAAGTCCGAGAACGCTCTACGCCAGCTGCACCAGCTCTTTTGCGAC
TCGAACATGTCTGTTCAACACAAGCAGTCGCTCATTTACTATATTTTGCTCGACTTTGACACGGAAAGCTCGCAG
TCGTCCACGTCCGATACATTTGCCGCGGATGCCGGTATGCCCGTCAACTATCAGATTTTCATGAGGGGCTTGTGG
CTCATGGACCGGCAGCAGTTCAAGGAGGCCCTCAAGTTCGTGGCGCACCCTTCACTGAAGCCCGACTTTGCCGAC
GAAATCATCATTACGCTGGTTCACCGACTCTGA
Transcript >Ophcf2|02151
ATGGCTGCGATGGAAGGCGTCACAGACTTTGAACGAGTCTTCCCCAGCAGCTTGAAATTCCCTTACGATCGCACC
CTTCAGCATGAGATTGAGCATCATCGCAAGGCAGTGGGCGGCACTCTCTTCATCGACCGCGTCATGACCACTCTT
GGTCTTGTCAAAGGCCGAACCTATCCTCCCAAGTCCGAGAACGCTCTACGCCAGCTGCACCAGCTCTTTTGCGAC
TCGAACATGTCTGTTCAACACAAGCAGTCGCTCATTTACTATATTTTGCTCGACTTTGACACGGAAAGCTCGCAG
TCGTCCACGTCCGATACATTTGCCGCGGATGCCGGTATGCCCGTCAACTATCAGATTTTCATGAGGGGCTTGTGG
CTCATGGACCGGCAGCAGTTCAAGGAGGCCCTCAAGTTCGTGGCGCACCCTTCACTGAAGCCCGACTTTGCCGAC
GAAATCATCATTACGCTGGTTCACCGACTCTGA
Gene >Ophcf2|02151
ATGGCTGCGATGGAAGGCGTCACAGACTTTGAACGAGTCTTCCCCAGCAGCTTGAAATTCCCTTACGATCGCACC
CTTCAGCATGAGATTGAGCATCATCGCAAGGCAGTGGGCGGCACTCTCTTCATCGACCGCGTCATGACCACTCTT
GGTCTTGTCAAAGGTCCACCTCTTTATCCATGTATAAGATTAATATTCTGATGCTGACGGCGTTGTGTGAAGGCC
GAACCTATCCTCCCAAGTCCGAGAACGCTCTACGCCAGCTGCACCAGCTCTTTTGCGACTCGAACATGTCTGTTC
AACACAAGCAGTCGCTCATTTACTATATTTTGCTCGACTTTGACACGGAAAGCTCGCAGTCGTCCACGTCCGATA
CATTTGCCGCGGATGCCGGTATGCCCGTCAACTATCAGATTTTCATGAGGGGCTTGTGGCTCATGGACCGGCAGC
AGTTCAAGGTCGTTCGCCTCGAAAGTCGTGTGCATTCGGAAATCTTACTGACGAATCTGCACCGTCTTACAGGAG
GCCCTCAAGTTCGTGGCGCACCCTTCACTGAAGCCCGACTTTGCCGACGAAATCATCATTACGCTGGTTCGTTAC
GCTCCAGATAACCATGGCCTCGCTCTGTCATATTTTTACTCGATGAGACCGACTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail