Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02142
Gene name
Locationscaffold_02:2746645..2748063
Strand-
Gene length (bp)1418
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.6E-31 324 431
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 3.4E-30 216 314
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.7E-20 7 75

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2223 0.157 0.0742 0.0426 0.8795 0.4428 0.356 0.1766 0.1677 0.3282

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4878
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6757
Ophiocordyceps camponoti-floridani Ophcf2|02142 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6897
Ophiocordyceps kimflemingae Ophio5|3946
Ophiocordyceps subramaniannii Hirsu2|11136

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02142
MEYDEMQVATHNTPEDTWLVIHGKVYDLTKYMVDHPGGPEIINETAGLDASENFDNAGHSEDAFDLMKDLCVGTL
KGFKKKSDKPPRVQIKRKPEAPEKDPARPLSKLVNQGIFMSATTAIYFLAFRSHHVPKAFVNFIRDSSGDPHRHG
FFKGLLIGAGAFSILDLWAGRRFTKAFLNRTKGFESYPAHIKMPPVVEKDELLQSGWLDPVNYSNLPLKAKTEVT
PNVWRFTFSLPTEKDILGLPIGQHVAIKAQIDGENVSRSYTPVSNNHDKGVLELVIKIYPDGKLTNGLLSNIEVG
DTVPFRGPKGAMRYHRGLCKKIGMVAGGTGITPMYQLIRAICEDDRDLTRVSLIYANRSEDDILLRKELDAFARK
YPQNFEVYYVVDHPPPGWKYGSGHVDQDLMKKKLPGPKDGSKMMLCGPPGMVNACKAGLGNLGFTLPGVASKITD
QIFLF*
Coding >Ophcf2|02142
ATGGAGTACGACGAGATGCAGGTTGCTACGCACAACACGCCGGAGGATACCTGGCTGGTCATCCACGGAAAAGTC
TACGACTTGACAAAGTACATGGTGGACCATCCCGGAGGTCCAGAAATCATCAACGAGACAGCCGGACTTGATGCC
AGCGAGAACTTTGACAATGCAGGCCACTCGGAGGATGCCTTTGACTTGATGAAGGATCTCTGCGTCGGAACCCTC
AAGGGCTTCAAGAAGAAGTCGGACAAGCCACCAAGGGTACAGATCAAGCGCAAGCCCGAGGCCCCAGAGAAGGAT
CCCGCCCGGCCGCTGTCCAAGCTGGTCAACCAGGGCATCTTCATGAGTGCCACGACGGCCATCTACTTCCTTGCC
TTTCGCTCTCATCACGTTCCCAAGGCCTTTGTCAACTTCATCCGGGACTCTTCCGGTGATCCGCATCGACACGGC
TTCTTCAAGGGTCTGCTGATCGGAGCTGGTGCCTTTTCCATTCTCGATCTCTGGGCTGGTCGTCGGTTTACAAAG
GCCTTCCTCAACCGCACAAAGGGCTTCGAGTCGTACCCTGCTCACATCAAGATGCCTCCCGTGGTGGAGAAGGAT
GAGCTGTTGCAGAGCGGCTGGTTAGACCCCGTCAACTATTCCAACCTGCCGCTCAAGGCCAAGACGGAGGTTACC
CCCAACGTTTGGCGCTTCACCTTTAGTCTCCCCACGGAGAAGGACATCCTCGGCCTGCCCATAGGTCAGCACGTC
GCCATCAAGGCTCAGATAGACGGCGAGAACGTCTCTCGCTCGTACACGCCCGTCTCCAACAACCACGACAAGGGC
GTCCTCGAGCTCGTCATCAAGATCTACCCGGACGGCAAGCTTACCAATGGCCTTCTCTCCAACATCGAGGTGGGC
GATACGGTGCCCTTCCGAGGTCCCAAGGGCGCCATGCGTTACCACCGTGGCCTCTGCAAGAAGATTGGCATGGTG
GCCGGAGGCACGGGCATCACGCCCATGTATCAGCTCATCAGGGCCATCTGCGAGGACGACCGCGACCTCACGCGC
GTCAGTCTCATCTACGCCAACAGATCGGAGGACGACATCCTCCTCCGAAAAGAGCTGGATGCCTTTGCCCGAAAA
TACCCGCAGAACTTTGAGGTTTACTACGTGGTCGACCATCCGCCTCCGGGCTGGAAGTACGGCAGCGGCCACGTA
GACCAGGATCTCATGAAGAAGAAGCTTCCCGGACCCAAGGACGGTTCCAAGATGATGCTTTGCGGACCTCCCGGA
ATGGTCAACGCTTGCAAGGCAGGGCTGGGGAACTTGGGCTTCACTCTGCCGGGCGTGGCGTCTAAGATAACGGAC
CAGATCTTTTTGTTTTGA
Transcript >Ophcf2|02142
ATGGAGTACGACGAGATGCAGGTTGCTACGCACAACACGCCGGAGGATACCTGGCTGGTCATCCACGGAAAAGTC
TACGACTTGACAAAGTACATGGTGGACCATCCCGGAGGTCCAGAAATCATCAACGAGACAGCCGGACTTGATGCC
AGCGAGAACTTTGACAATGCAGGCCACTCGGAGGATGCCTTTGACTTGATGAAGGATCTCTGCGTCGGAACCCTC
AAGGGCTTCAAGAAGAAGTCGGACAAGCCACCAAGGGTACAGATCAAGCGCAAGCCCGAGGCCCCAGAGAAGGAT
CCCGCCCGGCCGCTGTCCAAGCTGGTCAACCAGGGCATCTTCATGAGTGCCACGACGGCCATCTACTTCCTTGCC
TTTCGCTCTCATCACGTTCCCAAGGCCTTTGTCAACTTCATCCGGGACTCTTCCGGTGATCCGCATCGACACGGC
TTCTTCAAGGGTCTGCTGATCGGAGCTGGTGCCTTTTCCATTCTCGATCTCTGGGCTGGTCGTCGGTTTACAAAG
GCCTTCCTCAACCGCACAAAGGGCTTCGAGTCGTACCCTGCTCACATCAAGATGCCTCCCGTGGTGGAGAAGGAT
GAGCTGTTGCAGAGCGGCTGGTTAGACCCCGTCAACTATTCCAACCTGCCGCTCAAGGCCAAGACGGAGGTTACC
CCCAACGTTTGGCGCTTCACCTTTAGTCTCCCCACGGAGAAGGACATCCTCGGCCTGCCCATAGGTCAGCACGTC
GCCATCAAGGCTCAGATAGACGGCGAGAACGTCTCTCGCTCGTACACGCCCGTCTCCAACAACCACGACAAGGGC
GTCCTCGAGCTCGTCATCAAGATCTACCCGGACGGCAAGCTTACCAATGGCCTTCTCTCCAACATCGAGGTGGGC
GATACGGTGCCCTTCCGAGGTCCCAAGGGCGCCATGCGTTACCACCGTGGCCTCTGCAAGAAGATTGGCATGGTG
GCCGGAGGCACGGGCATCACGCCCATGTATCAGCTCATCAGGGCCATCTGCGAGGACGACCGCGACCTCACGCGC
GTCAGTCTCATCTACGCCAACAGATCGGAGGACGACATCCTCCTCCGAAAAGAGCTGGATGCCTTTGCCCGAAAA
TACCCGCAGAACTTTGAGGTTTACTACGTGGTCGACCATCCGCCTCCGGGCTGGAAGTACGGCAGCGGCCACGTA
GACCAGGATCTCATGAAGAAGAAGCTTCCCGGACCCAAGGACGGTTCCAAGATGATGCTTTGCGGACCTCCCGGA
ATGGTCAACGCTTGCAAGGCAGGGCTGGGGAACTTGGGCTTCACTCTGCCGGGCGTGGCGTCTAAGATAACGGAC
CAGATCTTTTTGTTTTGA
Gene >Ophcf2|02142
ATGGAGTACGACGAGATGCAGGTTGCTACGCACAACACGCCGGAGGATACCTGGCTGGTCATCCACGGAAAAGGT
GAGAGAGAAAGGAAGACGAGCCATGACACGATGCTAATCCCTCGACAGTCTACGACTTGACAAAGTACATGGTGG
ACCATCCCGGAGGTCCAGAAATCATCAACGAGACAGCCGGACTTGATGCCAGCGAGAACTTTGACAATGCAGGCC
ACTCGGAGGATGCCTTTGACTTGATGAAGGATCTCTGCGTCGGAACCCTCAAGGGCTTCAAGAAGAAGTCGGACA
AGCCACCAAGGGTACAGATCAAGCGCAAGCCCGAGGCCCCAGAGAAGGATCCCGCCCGGCCGCTGTCCAAGCTGG
TCAACCAGGGCATCTTCATGAGTGCCACGACGGCCATCTACTTCCTTGCCTTTCGCTCTCATCACGTTCCCAAGG
CCTTTGTCAACTTCATCCGGGACTCTTCCGGTGATCCGCATCGACACGGCTTCTTCAAGGGTCTGCTGATCGGAG
CTGGTGCCTTTTCCATTCTCGATCTCTGGGCTGGTCGTCGGTTTACAAAGGCCTTCCTCAACCGCACAAAGGGCT
TCGAGTCGTACCCTGCTCACATCAAGATGCCTCCCGTGGTGGAGAAGGATGAGCTGTTGCAGAGCGGCTGGTTAG
ACCCCGTCAACTATTCCAACCTGCCGCTCAAGGCCAAGACGGAGGTTACCCCCAACGTTTGGCGCTTCACCTTTA
GTCTCCCCACGGAGAAGGACATCCTCGGCCTGCCCATAGGTCAGCACGTCGCCATCAAGGCTCAGATAGACGGCG
AGAACGTCTCTCGCTCGTACACGCCCGTCTCCAACAACCACGACAAGGGCGTCCTCGAGCTCGTCATCAAGATCT
ACCCGGACGGCAAGCTTACCAATGGCCTTCTCTCCAACATCGAGGTGGGCGATACGGTGCCCTTCCGAGGTCCCA
AGGGCGCCATGCGTTACCACCGTGGCCTCTGCAAGAAGATTGGCATGGTGGCCGGAGGCACGGGCATCACGCCCA
TGTATCAGCTCATCAGGGCCATCTGCGAGGACGACCGCGACCTCACGCGCGTCAGTCTCATCTACGCCAACAGAT
CGGAGGACGACATCCTCCTCCGAAAAGAGCTGGATGCCTTTGCCCGAAAATACCCGCAGAACTTTGAGGTTTACT
ACGTGGTCGACCATCCGCCTCCGGGCTGGAAGTACGGCAGCGGCCACGTAGACCAGGATCTCATGAAGAAGAAGC
TTCCCGGACCCAAGGACGGTTCCAAGATGATGCTTTGCGGACCTCCCGGAATGGTCAACGCTTGCAAGGCAGGGC
TGGGGAACTTGGGCTTCACTCTGCCGGGCGTGGCGTCTAAGATAACGGACCAGATCTTTTTGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail