Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02133
Gene name
Locationscaffold_02:2677507..2680201
Strand-
Gene length (bp)2694
Transcript length (bp)2391
Coding sequence length (bp)2391
Protein length (aa) 797

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12752 SUZ SUZ domain 4.6E-14 364 430
PF01424 R3H R3H domain 2.5E-07 276 320

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.71 0.3588 0.1165 0.0904 0.0552 0.0029 0.1083 0.0519 0.086 0.0006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3480
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1489
Ophiocordyceps australis map64 (Brazil) OphauB2|4991
Ophiocordyceps camponoti-floridani Ophcf2|02133 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6905
Ophiocordyceps kimflemingae Ophio5|2167
Ophiocordyceps subramaniannii Hirsu2|6643

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02133
MATAQVSPDVPRPSFAKVTTSVSTEAPSGPSSAHDKAASAKHQRSAALPIVVSSVSTSAVLPRNISPAPPRGDGA
PKPYAAVADRATSSLQDLKLGHRVPHFDVTSTTLDRQRAAVSRESVSDESQKCDSSSELGTKPPSLDGKSITSGT
TFALDEKESLRPDDSASVKAAAEDDDAFSHRGSLIAGSRMSSEVAARGRNIQLGDIPERRSAERPLGTPGHGLPT
PQSSASERPPAANPAMPLSADMSSDALNVIYRQAPDDKLLDALTSPRDRYFLLRLEKDVINFVQDSKEPYMDLPP
SNAFCRMLTHKLADYYHMTHSYEPHIGAVRIFRTPFCRVPPSLATMGPQPSASTASTPPPALLPKKIMRRGQDNE
SGLVSAGASKPTSESGSDNNKDGKDKQPVAKEKLSREEREEIYKLARERIFGSSEEIAQENEGENGMSRASSVSA
TNKAGVSKRGKTGKQRRDDSDSFDSRYQYTPYWGPQQQTWVAQPHGQLMAPIPGQLAGPPMPVYPPQATAAAPAY
GQQPPAPYAAVSNMAPNPAYPAYAMPQMPPQHAPPRYPSGGSPMTAYGSSVPPPAGMPPLGWQPNFGAPSYPPPG
GPAPPVASQAQVGLPYAYGQLPANPNPNDPKSQHPIPGSYNRSHAFNPKTQSFVPGGNGIHPVPPPQPPFTAPGS
HHGSPQIGTPHLAYGGYQTGPPPPPPPPPPPYAGGYGMVRQESNTSIPPYHGPPQHVPLMPTMVPPPLQPMAQNG
PPPMQPNPPTHMAGRPAAPKGPSQMYSHLPTYGNPATLPQKPASGI*
Coding >Ophcf2|02133
ATGGCCACTGCCCAGGTGTCTCCAGACGTGCCTCGGCCGTCCTTTGCCAAGGTAACCACTTCGGTTTCTACCGAG
GCTCCATCTGGTCCCTCGTCGGCTCACGATAAGGCTGCGAGCGCCAAGCATCAACGCTCCGCTGCGTTACCAATC
GTTGTCAGCAGCGTGTCGACGAGTGCCGTCCTCCCGCGAAACATCTCACCTGCCCCGCCCCGTGGCGACGGCGCT
CCAAAGCCGTACGCAGCTGTTGCGGACAGGGCGACATCATCACTCCAGGATCTCAAGCTCGGCCATAGAGTGCCT
CACTTCGATGTGACTAGTACTACGCTCGATCGCCAGCGCGCGGCAGTAAGCAGGGAGAGCGTATCCGATGAATCG
CAGAAGTGCGACTCCAGCTCTGAGCTGGGAACAAAACCCCCGAGCTTAGATGGCAAGAGCATCACGTCCGGAACT
ACGTTTGCTCTTGACGAGAAAGAGTCTCTTCGGCCTGACGACAGTGCTAGCGTCAAGGCCGCGGCCGAGGATGAT
GATGCCTTCTCGCACCGGGGGTCCCTCATTGCCGGCTCTCGAATGAGCTCTGAGGTCGCAGCCCGAGGACGCAAT
ATCCAGCTCGGAGATATCCCGGAGCGCAGGTCGGCGGAGCGGCCCCTCGGGACCCCGGGACACGGCCTCCCGACT
CCCCAGAGCTCGGCATCGGAACGACCGCCAGCCGCTAATCCGGCGATGCCGTTGAGTGCCGACATGTCCTCCGAC
GCTCTCAATGTCATATACAGGCAGGCGCCCGATGACAAGCTGCTCGACGCCCTGACGAGCCCGAGGGACAGATAT
TTTCTTCTGAGGCTGGAGAAGGATGTCATCAATTTCGTTCAGGATTCCAAGGAGCCATACATGGACCTACCCCCT
TCCAACGCCTTTTGCAGGATGTTGACGCACAAGCTAGCCGACTATTACCATATGACGCATTCTTACGAGCCGCAC
ATTGGTGCTGTTCGCATTTTCAGGACCCCATTCTGTCGTGTGCCACCCTCTCTGGCGACCATGGGGCCTCAGCCG
AGCGCCTCGACGGCTAGCACTCCGCCTCCCGCTCTTCTTCCCAAGAAGATCATGCGTCGTGGCCAAGACAACGAG
AGCGGCCTGGTCAGTGCCGGTGCATCGAAGCCCACCTCGGAAAGTGGCAGCGACAACAACAAGGACGGGAAGGAC
AAGCAACCGGTGGCAAAAGAAAAGTTATCGAGAGAGGAGCGGGAGGAGATCTACAAGCTGGCTAGGGAACGCATC
TTTGGCAGCTCTGAAGAGATTGCTCAAGAGAACGAAGGTGAGAACGGCATGTCTCGTGCGAGCTCCGTCTCTGCC
ACCAACAAGGCCGGCGTCAGCAAACGCGGCAAGACGGGCAAGCAGCGACGGGACGACTCGGACAGCTTCGATTCC
AGATACCAGTATACACCGTACTGGGGTCCTCAGCAGCAGACGTGGGTGGCGCAACCACACGGACAGCTTATGGCT
CCGATCCCGGGCCAGCTCGCCGGCCCGCCCATGCCTGTATACCCGCCACAGGCGACGGCGGCGGCGCCCGCCTAC
GGCCAGCAGCCCCCGGCTCCCTACGCCGCCGTCTCCAACATGGCGCCGAACCCGGCATACCCGGCTTACGCGATG
CCCCAGATGCCACCGCAACACGCCCCTCCGCGGTATCCATCCGGAGGAAGTCCGATGACAGCGTACGGCTCTTCC
GTGCCTCCGCCTGCCGGCATGCCGCCGCTGGGATGGCAGCCGAACTTTGGCGCCCCGTCCTATCCCCCGCCAGGA
GGACCTGCACCCCCCGTGGCGTCGCAGGCACAGGTAGGCCTTCCCTACGCCTATGGGCAGCTGCCAGCGAATCCC
AATCCCAACGACCCCAAGAGCCAGCACCCGATCCCGGGCAGCTACAACAGGAGCCACGCCTTCAACCCCAAGACG
CAGTCGTTCGTCCCTGGCGGCAACGGCATCCACCCGGTCCCGCCGCCCCAGCCACCGTTCACGGCCCCCGGGTCT
CACCACGGCAGCCCGCAGATCGGAACGCCGCATCTCGCGTATGGCGGCTATCAGACGGGCCCGCCGCCGCCGCCG
CCGCCGCCGCCGCCGCCTTATGCGGGAGGCTACGGCATGGTCAGGCAAGAATCGAACACGTCGATACCGCCGTAT
CACGGGCCACCTCAGCACGTCCCGCTGATGCCGACCATGGTGCCTCCGCCACTGCAGCCGATGGCGCAGAACGGC
CCGCCGCCTATGCAGCCGAACCCCCCGACGCACATGGCTGGCAGACCGGCAGCTCCAAAGGGGCCCAGCCAGATG
TACAGCCACCTGCCAACCTACGGCAACCCGGCGACGCTGCCTCAGAAACCTGCTTCCGGCATTTAG
Transcript >Ophcf2|02133
ATGGCCACTGCCCAGGTGTCTCCAGACGTGCCTCGGCCGTCCTTTGCCAAGGTAACCACTTCGGTTTCTACCGAG
GCTCCATCTGGTCCCTCGTCGGCTCACGATAAGGCTGCGAGCGCCAAGCATCAACGCTCCGCTGCGTTACCAATC
GTTGTCAGCAGCGTGTCGACGAGTGCCGTCCTCCCGCGAAACATCTCACCTGCCCCGCCCCGTGGCGACGGCGCT
CCAAAGCCGTACGCAGCTGTTGCGGACAGGGCGACATCATCACTCCAGGATCTCAAGCTCGGCCATAGAGTGCCT
CACTTCGATGTGACTAGTACTACGCTCGATCGCCAGCGCGCGGCAGTAAGCAGGGAGAGCGTATCCGATGAATCG
CAGAAGTGCGACTCCAGCTCTGAGCTGGGAACAAAACCCCCGAGCTTAGATGGCAAGAGCATCACGTCCGGAACT
ACGTTTGCTCTTGACGAGAAAGAGTCTCTTCGGCCTGACGACAGTGCTAGCGTCAAGGCCGCGGCCGAGGATGAT
GATGCCTTCTCGCACCGGGGGTCCCTCATTGCCGGCTCTCGAATGAGCTCTGAGGTCGCAGCCCGAGGACGCAAT
ATCCAGCTCGGAGATATCCCGGAGCGCAGGTCGGCGGAGCGGCCCCTCGGGACCCCGGGACACGGCCTCCCGACT
CCCCAGAGCTCGGCATCGGAACGACCGCCAGCCGCTAATCCGGCGATGCCGTTGAGTGCCGACATGTCCTCCGAC
GCTCTCAATGTCATATACAGGCAGGCGCCCGATGACAAGCTGCTCGACGCCCTGACGAGCCCGAGGGACAGATAT
TTTCTTCTGAGGCTGGAGAAGGATGTCATCAATTTCGTTCAGGATTCCAAGGAGCCATACATGGACCTACCCCCT
TCCAACGCCTTTTGCAGGATGTTGACGCACAAGCTAGCCGACTATTACCATATGACGCATTCTTACGAGCCGCAC
ATTGGTGCTGTTCGCATTTTCAGGACCCCATTCTGTCGTGTGCCACCCTCTCTGGCGACCATGGGGCCTCAGCCG
AGCGCCTCGACGGCTAGCACTCCGCCTCCCGCTCTTCTTCCCAAGAAGATCATGCGTCGTGGCCAAGACAACGAG
AGCGGCCTGGTCAGTGCCGGTGCATCGAAGCCCACCTCGGAAAGTGGCAGCGACAACAACAAGGACGGGAAGGAC
AAGCAACCGGTGGCAAAAGAAAAGTTATCGAGAGAGGAGCGGGAGGAGATCTACAAGCTGGCTAGGGAACGCATC
TTTGGCAGCTCTGAAGAGATTGCTCAAGAGAACGAAGGTGAGAACGGCATGTCTCGTGCGAGCTCCGTCTCTGCC
ACCAACAAGGCCGGCGTCAGCAAACGCGGCAAGACGGGCAAGCAGCGACGGGACGACTCGGACAGCTTCGATTCC
AGATACCAGTATACACCGTACTGGGGTCCTCAGCAGCAGACGTGGGTGGCGCAACCACACGGACAGCTTATGGCT
CCGATCCCGGGCCAGCTCGCCGGCCCGCCCATGCCTGTATACCCGCCACAGGCGACGGCGGCGGCGCCCGCCTAC
GGCCAGCAGCCCCCGGCTCCCTACGCCGCCGTCTCCAACATGGCGCCGAACCCGGCATACCCGGCTTACGCGATG
CCCCAGATGCCACCGCAACACGCCCCTCCGCGGTATCCATCCGGAGGAAGTCCGATGACAGCGTACGGCTCTTCC
GTGCCTCCGCCTGCCGGCATGCCGCCGCTGGGATGGCAGCCGAACTTTGGCGCCCCGTCCTATCCCCCGCCAGGA
GGACCTGCACCCCCCGTGGCGTCGCAGGCACAGGTAGGCCTTCCCTACGCCTATGGGCAGCTGCCAGCGAATCCC
AATCCCAACGACCCCAAGAGCCAGCACCCGATCCCGGGCAGCTACAACAGGAGCCACGCCTTCAACCCCAAGACG
CAGTCGTTCGTCCCTGGCGGCAACGGCATCCACCCGGTCCCGCCGCCCCAGCCACCGTTCACGGCCCCCGGGTCT
CACCACGGCAGCCCGCAGATCGGAACGCCGCATCTCGCGTATGGCGGCTATCAGACGGGCCCGCCGCCGCCGCCG
CCGCCGCCGCCGCCGCCTTATGCGGGAGGCTACGGCATGGTCAGGCAAGAATCGAACACGTCGATACCGCCGTAT
CACGGGCCACCTCAGCACGTCCCGCTGATGCCGACCATGGTGCCTCCGCCACTGCAGCCGATGGCGCAGAACGGC
CCGCCGCCTATGCAGCCGAACCCCCCGACGCACATGGCTGGCAGACCGGCAGCTCCAAAGGGGCCCAGCCAGATG
TACAGCCACCTGCCAACCTACGGCAACCCGGCGACGCTGCCTCAGAAACCTGCTTCCGGCATTTAG
Gene >Ophcf2|02133
ATGGCCACTGCCCAGGTGTCTCCAGACGTGCCTCGGCCGTCCTTTGCCAAGGTATATTTGCTTTGACGAGCTTTG
TGTCGTCTACTACCAAATGCTAATACGAAATGAAATCGTTAGGTAACCACTTCGGTTTCTACCGAGGCTCCATCT
GGTCCCTCGTCGGCTCACGATAAGGCTGCGAGCGCCAAGCATCAACGCTCCGCTGCGTTACCAATCGTTGTCAGC
AGCGTGTCGACGAGTGCCGTCCTCCCGCGAAACATCTCACCTGCCCCGCCCCGTGGCGACGGCGCTCCAAAGCCG
TACGCAGCTGTTGCGGACAGGGCGACATCATCACTCCAGGATCTCAAGCTCGGCCATAGAGTGCCTCACTTCGAT
GTGACTAGTACTACGCTCGATCGCCAGCGCGCGGCAGTAAGCAGGGAGAGCGTATCCGATGAATCGCAGAAGTGC
GACTCCAGCTCTGAGCTGGGAACAAAACCCCCGAGCTTAGATGGCAAGAGCATCACGTCCGGAACTACGTTTGCT
CTTGACGAGAAAGAGTCTCTTCGGCCTGACGACAGTGCTAGCGTCAAGGCCGCGGCCGAGGATGATGATGCCTTC
TCGCACCGGGGGTCCCTCATTGCCGGCTCTCGAATGAGCTCTGAGGTCGCAGCCCGAGGACGCAATATCCAGCTC
GGAGATATCCCGGAGCGCAGGTCGGCGGAGCGGCCCCTCGGGACCCCGGGACACGGCCTCCCGACTCCCCAGAGC
TCGGCATCGGAACGACCGCCAGCCGCTAATCCGGCGATGCCGTTGAGTGCCGACATGTCCTCCGACGCTCTCAAT
GTCATATACAGGCAGGCGCCCGATGACAAGCTGCTCGACGCCCTGACGAGCCCGAGGGACAGATATTTTCTTCTG
AGGCTGGAGAAGGATGTCATCAATTTCGTTCAGGATTCCAAGTAAGGCTACTTGAAGCTTCGAACTCTTCGTCTT
CTTTCCTTGCTGACGTTCTCAGGGAGCCATACATGGACCTACCCCCTTCCAACGCCTTTTGCAGGATGTTGACGC
ACAAGCTAGCCGACTATTACCATATGACGCATTCTTACGAGCCGCACATTGGTGCTGTTCGCATTTTCAGGACCC
CATTCTGTCGTGTGCCACCCTCTCTGGCGACCATGGGGCCTCAGCCGAGCGCCTCGACGGCTAGCACTCCGCCTC
CCGCTCTTCTTCCCAAGAAGATCATGCGTCGTGGCCAAGACAACGAGAGCGGCCTGGTCAGTGCCGGTGCATCGA
AGCCCACCTCGGAAAGTGGCAGCGACAACAACAAGGACGGGAAGGACAAGCAACCGGTGGCAAAAGAAAAGTGAG
CAACACCCGCTGCGGAGACGTCGTTCCAGTTCCCGAAACCTGACCCTGCCATCACCAGGTTATCGAGAGAGGAGC
GGGAGGAGATCTACAAGCTGGCTAGGGAACGCATCTTTGGCAGCTCTGAAGAGATTGCTCAAGGTAAGACTGGCC
CTTGCTCCAATTTTCGCTCGATGGAATCGAAAACTGACGTCGTCCCGTATAGAGAACGAAGGTGAGAACGGCATG
TCTCGTGCGAGCTCCGTCTCTGCCACCAACAAGGCCGGCGTCAGCAAACGCGGCAAGACGGGCAAGCAGCGACGG
GACGACTCGGACAGCTTCGATTCCAGATACCAGTATACACCGTACTGGGGTCCTCAGCAGCAGACGTGGGTGGCG
CAACCACACGGACAGCTTATGGCTCCGATCCCGGGCCAGCTCGCCGGCCCGCCCATGCCTGTATACCCGCCACAG
GCGACGGCGGCGGCGCCCGCCTACGGCCAGCAGCCCCCGGCTCCCTACGCCGCCGTCTCCAACATGGCGCCGAAC
CCGGCATACCCGGCTTACGCGATGCCCCAGGTTAGAGCGGAGCATGGAAGTTGGCGTTCGTCTCCAGTGACTGAC
AGGTAGCAGATGCCACCGCAACACGCCCCTCCGCGGTATCCATCCGGAGGAAGTCCGATGACAGCGTACGGCTCT
TCCGTGCCTCCGCCTGCCGGCATGCCGCCGCTGGGATGGCAGCCGAACTTTGGCGCCCCGTCCTATCCCCCGCCA
GGAGGACCTGCACCCCCCGTGGCGTCGCAGGCACAGGTAGGCCTTCCCTACGCCTATGGGCAGCTGCCAGCGAAT
CCCAATCCCAACGACCCCAAGAGCCAGCACCCGATCCCGGGCAGCTACAACAGGAGCCACGCCTTCAACCCCAAG
ACGCAGTCGTTCGTCCCTGGCGGCAACGGCATCCACCCGGTCCCGCCGCCCCAGCCACCGTTCACGGCCCCCGGG
TCTCACCACGGCAGCCCGCAGATCGGAACGCCGCATCTCGCGTATGGCGGCTATCAGACGGGCCCGCCGCCGCCG
CCGCCGCCGCCGCCGCCGCCTTATGCGGGAGGCTACGGCATGGTCAGGCAAGAATCGAACACGTCGATACCGCCG
TATCACGGGCCACCTCAGCACGTCCCGCTGATGCCGACCATGGTGCCTCCGCCACTGCAGCCGATGGCGCAGAAC
GGCCCGCCGCCTATGCAGCCGAACCCCCCGACGCACATGGCTGGCAGACCGGCAGCTCCAAAGGGGCCCAGCCAG
ATGTACAGCCACCTGCCAACCTACGGCAACCCGGCGACGCTGCCTCAGAAACCTGCTTCCGGCATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail