Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02119
Gene name
Locationscaffold_02:2640599..2641458
Strand+
Gene length (bp)859
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06916 FAM210A-B_dom FAM210A/B-like domain 7.5E-24 77 231

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0675 0.115 0.0277 0.0623 0.9704 0.0378 0.0379 0.0346 0.1011 0.0118

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3787
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6179
Ophiocordyceps australis map64 (Brazil) OphauB2|4978
Ophiocordyceps camponoti-floridani Ophcf2|02119 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6517
Ophiocordyceps kimflemingae Ophio5|8122
Ophiocordyceps subramaniannii Hirsu2|739

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02119
MFALARGSRHPAATGVWKRLYSFETRKTAKGPRQWRSLPMRYDVKHALQRRAFNLSAWRRAAGDAGKAPQRLSLG
ARLKKLSKEYGWSAVGVYLALSVLDFPFCFLLVKVVGTEKIGKMEHYVVSILSKLIPESMMQRWRAYRHATADSQ
QQLQQQQQQQQQQQQQQQQQQQQQQQTGSDGGAATVRWGVEEAQRSNDEEASLATQLALAYAIHKSFIFVRVPLT
AAVTPKVVKVLRSWGWNIGKRR*
Coding >Ophcf2|02119
ATGTTTGCTCTGGCCAGAGGGAGCCGGCATCCGGCCGCAACCGGCGTGTGGAAGAGGCTCTACAGCTTCGAGACG
AGAAAGACGGCCAAGGGACCGAGACAATGGCGCAGTTTACCGATGCGCTACGATGTGAAGCACGCGTTACAACGA
CGGGCCTTTAACCTGTCGGCCTGGAGACGCGCCGCTGGCGACGCGGGCAAGGCGCCGCAGAGGCTATCGCTGGGC
GCGAGGCTGAAGAAGCTCTCCAAGGAATACGGATGGTCGGCTGTGGGCGTCTATCTGGCCCTCAGCGTCTTAGAC
TTTCCCTTTTGCTTTCTGCTCGTCAAGGTGGTTGGCACGGAAAAGATTGGCAAAATGGAGCACTACGTCGTCTCT
ATCCTGTCGAAATTAATACCCGAATCCATGATGCAACGGTGGCGCGCGTATCGACACGCCACGGCCGATAGCCAG
CAGCAGCTACAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGACGGGCAGCGACGGCGGGGCGGCAACGGTGCGCTGGGGGGTGGAGGAGGCGCAACGCAGCAACGACGAGGAA
GCCAGTTTGGCGACGCAGCTGGCGCTCGCCTACGCCATCCACAAGAGCTTCATCTTCGTCCGGGTGCCTCTAACG
GCAGCGGTGACACCCAAGGTGGTCAAGGTGCTGAGGAGTTGGGGGTGGAACATTGGCAAGCGACGATGA
Transcript >Ophcf2|02119
ATGTTTGCTCTGGCCAGAGGGAGCCGGCATCCGGCCGCAACCGGCGTGTGGAAGAGGCTCTACAGCTTCGAGACG
AGAAAGACGGCCAAGGGACCGAGACAATGGCGCAGTTTACCGATGCGCTACGATGTGAAGCACGCGTTACAACGA
CGGGCCTTTAACCTGTCGGCCTGGAGACGCGCCGCTGGCGACGCGGGCAAGGCGCCGCAGAGGCTATCGCTGGGC
GCGAGGCTGAAGAAGCTCTCCAAGGAATACGGATGGTCGGCTGTGGGCGTCTATCTGGCCCTCAGCGTCTTAGAC
TTTCCCTTTTGCTTTCTGCTCGTCAAGGTGGTTGGCACGGAAAAGATTGGCAAAATGGAGCACTACGTCGTCTCT
ATCCTGTCGAAATTAATACCCGAATCCATGATGCAACGGTGGCGCGCGTATCGACACGCCACGGCCGATAGCCAG
CAGCAGCTACAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGACGGGCAGCGACGGCGGGGCGGCAACGGTGCGCTGGGGGGTGGAGGAGGCGCAACGCAGCAACGACGAGGAA
GCCAGTTTGGCGACGCAGCTGGCGCTCGCCTACGCCATCCACAAGAGCTTCATCTTCGTCCGGGTGCCTCTAACG
GCAGCGGTGACACCCAAGGTGGTCAAGGTGCTGAGGAGTTGGGGGTGGAACATTGGCAAGCGACGATGA
Gene >Ophcf2|02119
ATGTTTGCTCTGGCCAGAGGGAGCCGGCATCCGGCCGCAACCGGCGTGTGGAAGAGGCTCTACAGCTTCGAGACG
AGAAAGACGGCCAAGGGACCGAGACAATGGCGCAGTTTACCGATGCGCTACGATGTGAAGCACGCGTTACAACGA
CGGGCCTTTAACCTGTCGGCCTGGAGACGCGCCGCTGGCGACGCGGGCAAGGCGCCGCAGAGGCTATCGCTGGGC
GCGAGGCTGAAGAAGCTCTCCAAGGAATACGGATGGTCGGCTGTGGGCGTCTATCTGGCCCTCAGCGTCTTAGAC
TTTCCCTTTTGCTTTCTGCTCGTCAAGGTGGTTGGCACGGAAAAGATTGGTATGTCGATACTCTCTCCTTCCTTC
TTGGCTGGCGGCTTACACGGCGGCTCCGAGCAAAGGCAAAATGGAGCACTACGTCGTCTCTATCCTGTCGAAATT
AATACCCGAATCCATGATGCAACGGTGGCGCGCGTATCGACACGCCACGGCCGATAGCCAGCAGCAGCTACAGCA
GCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGACGGGCAGCGA
CGGCGGGGCGGCAACGGTGCGCTGGGGGGTGGAGGAGGCGCAACGCAGCAACGACGAGGAAGCCAGTAGGTTCTA
CGCAGGGTCGTCGCATGGGCAGGAGACGCTGACCAAGCGTACAGGTTTGGCGACGCAGCTGGCGCTCGCCTACGC
CATCCACAAGAGCTTCATCTTCGTCCGGGTGCCTCTAACGGCAGCGGTGACACCCAAGGTGGTCAAGGTGCTGAG
GAGTTGGGGGTGGAACATTGGCAAGCGACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail