Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02113
Gene name
Locationscaffold_02:2629959..2631616
Strand+
Gene length (bp)1657
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 4.5E-75 24 441

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 506 523 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02113
MNSIPAFAPTPIAEISDGYHRVRSTFRSGRLRDLEYRKKQIRRLYWGLDDMRPVLIEALRRDMGKCAHEANLTEI
DWVQVEAIGICDHLDDWASDESVVNLPFSFRLMKPRIRHEPLGTLLIIGAYNFPVMLGVTAVLGALAAGNTVVIK
PSEQSPHSAMALGQLFDRYLDPDLVYCVNGSISETQVLLDLKFDKVAFTGGRKAGTIVASKAAQSLTPVLLELGG
RNPAFINEHANVAVAARRLLWQKCLNAGQICLTQNYVLIHRPLVTRFIEELKLQYRIFMPKGAKASPDFSRIVNQ
HHFRRIKAMLDNSNGKIVMGGGSDETSLFIEPTVVLVDDVDDSMMAEETFGPVWSIMPYDSLDEAIGVANRVDPT
PLALYTFGSDEENNKVLALVTSGGACINDGMFHASLQATPLGGVGGSGMGNYHGYYSFRAFSHQRVICNVPSWSD
RILRVRYMPYSAPELRRYRKMLLPKPNFDREGNVVRDLSYWLGLVLALGGRGMKSIAVRWGVLIAVALGLGLGRR
FSL*
Coding >Ophcf2|02113
ATGAACTCCATCCCGGCCTTCGCGCCGACGCCCATAGCCGAAATCTCCGATGGCTACCACCGCGTCCGGTCCACC
TTCCGCTCCGGCCGCCTCCGCGACCTCGAGTACCGCAAGAAGCAGATCCGTCGCCTCTACTGGGGGCTCGACGAC
ATGCGTCCTGTCCTGATCGAGGCCCTGCGTCGCGACATGGGCAAGTGCGCGCACGAAGCCAACCTTACCGAGATC
GACTGGGTTCAGGTCGAGGCTATTGGCATATGCGATCATCTCGACGACTGGGCTTCCGATGAGTCCGTCGTTAAC
CTGCCCTTCTCCTTCCGCCTCATGAAACCGCGCATTCGTCACGAGCCTCTCGGCACCTTGCTCATCATTGGAGCC
TACAACTTCCCCGTCATGCTCGGCGTCACGGCCGTCTTGGGCGCTCTCGCCGCTGGAAATACCGTCGTCATCAAG
CCCTCGGAACAGTCGCCTCACTCGGCCATGGCCCTCGGCCAGCTGTTCGACCGCTACCTCGATCCGGACCTCGTC
TACTGCGTCAACGGCTCCATCTCCGAGACACAGGTTCTTCTCGACCTCAAGTTCGACAAGGTGGCCTTTACCGGC
GGCCGCAAGGCTGGCACAATCGTCGCCTCCAAGGCTGCTCAGTCCCTCACACCCGTCCTCCTCGAGCTCGGCGGC
CGGAATCCGGCCTTTATCAACGAGCATGCCAACGTCGCCGTCGCCGCCCGCCGCCTGCTCTGGCAAAAGTGCCTC
AACGCCGGCCAGATCTGTCTCACTCAAAACTACGTCCTCATCCACCGTCCTCTCGTCACGCGCTTCATCGAAGAG
CTCAAGCTCCAGTACCGCATCTTCATGCCCAAGGGCGCAAAGGCCAGTCCGGACTTTTCCCGCATCGTCAACCAG
CATCACTTCCGGCGCATCAAGGCCATGCTCGACAATTCAAACGGCAAGATTGTCATGGGCGGCGGTTCCGATGAG
ACGAGCCTCTTCATCGAGCCTACCGTTGTCCTGGTCGATGACGTCGACGACTCCATGATGGCCGAAGAGACTTTT
GGGCCCGTCTGGTCCATCATGCCTTACGATTCCCTCGATGAGGCCATCGGCGTGGCCAATCGTGTCGACCCCACA
CCGTTGGCCCTCTACACGTTTGGCTCCGACGAAGAGAATAACAAAGTGCTTGCTCTGGTCACATCGGGAGGAGCC
TGCATCAACGACGGCATGTTCCACGCCAGCTTGCAAGCTACTCCCTTGGGCGGTGTCGGTGGATCTGGCATGGGT
AACTACCATGGCTACTACTCCTTCCGCGCCTTCAGCCACCAGCGTGTCATCTGCAACGTACCGAGCTGGTCCGAC
AGGATCCTGCGCGTCCGCTACATGCCCTACTCGGCTCCCGAGCTCCGACGGTACAGAAAGATGCTGCTGCCTAAG
CCCAACTTCGATCGCGAAGGAAACGTCGTCCGCGACCTCTCGTACTGGCTCGGCCTGGTGCTGGCCCTCGGCGGC
AGGGGTATGAAGTCGATTGCAGTTCGGTGGGGGGTCCTCATTGCCGTGGCTCTCGGGCTGGGGCTGGGAAGAAGG
TTTTCCTTGTGA
Transcript >Ophcf2|02113
ATGAACTCCATCCCGGCCTTCGCGCCGACGCCCATAGCCGAAATCTCCGATGGCTACCACCGCGTCCGGTCCACC
TTCCGCTCCGGCCGCCTCCGCGACCTCGAGTACCGCAAGAAGCAGATCCGTCGCCTCTACTGGGGGCTCGACGAC
ATGCGTCCTGTCCTGATCGAGGCCCTGCGTCGCGACATGGGCAAGTGCGCGCACGAAGCCAACCTTACCGAGATC
GACTGGGTTCAGGTCGAGGCTATTGGCATATGCGATCATCTCGACGACTGGGCTTCCGATGAGTCCGTCGTTAAC
CTGCCCTTCTCCTTCCGCCTCATGAAACCGCGCATTCGTCACGAGCCTCTCGGCACCTTGCTCATCATTGGAGCC
TACAACTTCCCCGTCATGCTCGGCGTCACGGCCGTCTTGGGCGCTCTCGCCGCTGGAAATACCGTCGTCATCAAG
CCCTCGGAACAGTCGCCTCACTCGGCCATGGCCCTCGGCCAGCTGTTCGACCGCTACCTCGATCCGGACCTCGTC
TACTGCGTCAACGGCTCCATCTCCGAGACACAGGTTCTTCTCGACCTCAAGTTCGACAAGGTGGCCTTTACCGGC
GGCCGCAAGGCTGGCACAATCGTCGCCTCCAAGGCTGCTCAGTCCCTCACACCCGTCCTCCTCGAGCTCGGCGGC
CGGAATCCGGCCTTTATCAACGAGCATGCCAACGTCGCCGTCGCCGCCCGCCGCCTGCTCTGGCAAAAGTGCCTC
AACGCCGGCCAGATCTGTCTCACTCAAAACTACGTCCTCATCCACCGTCCTCTCGTCACGCGCTTCATCGAAGAG
CTCAAGCTCCAGTACCGCATCTTCATGCCCAAGGGCGCAAAGGCCAGTCCGGACTTTTCCCGCATCGTCAACCAG
CATCACTTCCGGCGCATCAAGGCCATGCTCGACAATTCAAACGGCAAGATTGTCATGGGCGGCGGTTCCGATGAG
ACGAGCCTCTTCATCGAGCCTACCGTTGTCCTGGTCGATGACGTCGACGACTCCATGATGGCCGAAGAGACTTTT
GGGCCCGTCTGGTCCATCATGCCTTACGATTCCCTCGATGAGGCCATCGGCGTGGCCAATCGTGTCGACCCCACA
CCGTTGGCCCTCTACACGTTTGGCTCCGACGAAGAGAATAACAAAGTGCTTGCTCTGGTCACATCGGGAGGAGCC
TGCATCAACGACGGCATGTTCCACGCCAGCTTGCAAGCTACTCCCTTGGGCGGTGTCGGTGGATCTGGCATGGGT
AACTACCATGGCTACTACTCCTTCCGCGCCTTCAGCCACCAGCGTGTCATCTGCAACGTACCGAGCTGGTCCGAC
AGGATCCTGCGCGTCCGCTACATGCCCTACTCGGCTCCCGAGCTCCGACGGTACAGAAAGATGCTGCTGCCTAAG
CCCAACTTCGATCGCGAAGGAAACGTCGTCCGCGACCTCTCGTACTGGCTCGGCCTGGTGCTGGCCCTCGGCGGC
AGGGGTATGAAGTCGATTGCAGTTCGGTGGGGGGTCCTCATTGCCGTGGCTCTCGGGCTGGGGCTGGGAAGAAGG
TTTTCCTTGTGA
Gene >Ophcf2|02113
ATGAACTCCATCCCGGCCTTCGCGCCGACGCCCATAGCCGAAATCTCCGATGGCTACCACCGCGTCCGGTCCACC
TTCCGCTCCGGCCGCCTCCGCGACCTCGAGTACCGCAAGAAGCAGATCCGTCGCCTCTACTGGGGGCTCGACGAC
ATGCGTCCTGTCCTGATCGAGGCCCTGCGTCGCGACATGGGCAAGTGCGCGCACGAAGCCAACCTTACCGAGATC
GACTGGGTTCAGGTCGAGGCTATTGGCATATGCGATCATCTCGACGACTGGGCTTCCGATGAGTCCGTCGTTAAC
CTGCCCTTCTCCTTCCGCCTCATGAAACCGCGCATTCGTCACGAGCCTCTCGGCACCTTGCTCATCATTGGAGCC
TACAACTTCCCCGTCATGCTCGGCGTCACGGCCGTCTTGGGCGCTCTCGCCGCTGGAAATACCGTCGTCATCAAG
CCCTCGGAACAGTCGCCTCACTCGGCCATGGCCCTCGGCCAGCTGTTCGACCGCTACCTCGATCCGGACCTCGTC
TACTGCGTCAACGGCTCCATCTCCGAGACACAGGTTCTTCTCGACCTCAAGTTCGACAAGGTGGCCTTTACCGGC
GGCCGCAAGGCTGGCACAATCGTCGCCTCCAAGGCTGCTCAGTCCCTCACACCCGTCCTCCTCGAGCTCGGCGGC
CGGAATCCGGCCTTTATCAACGAGCATGCCAACGTCGCCGTCGCCGCCCGCCGCCTGCTCTGGCAAAAGTGCCTC
AACGCCGGCCAGATCTGTCTCACTCAAAACTACGTCCTCATCCACCGTCCTCTCGTCACGCGCTTCATCGAAGAG
CTCAAGCTCCAGTACCGCATCTTCATGCCCAAGGGCGCAAAGGCCAGTCCGGACTTTTCCCGCATCGTCAACCAG
CATCACTTCCGGCGCATCAAGGCCATGCTCGACAATTCAAACGGCAAGATTGTCATGGGCGGCGGTTCCGATGAG
ACGAGCCTCTTCATCGAGCCTACCGTTGTCCTGGTCGATGACGTCGACGACTCCATGATGGCCGAAGAGACTTTT
GGGCCCGTCTGGTCCATCATGCCTTACGATTCCCTCGATGAGGCCATCGGCGTGGCCAATCGTGTCGACCCCACA
CCGTTGGCCCTCTACACGTTTGGCTCCGACGAAGAGAATAACAAAGGTCGGTCCTCCCTCATCCTCTTTTCCGTC
CGGCTTTCGATGGACAGATTGACTGACGGCGACGTAATTAGTGCTTGCTCTGGTCACATCGGGAGGAGCCTGCAT
CAACGACGGCATGTTCCACGCCAGCTTGCAAGCTACTCCCTTGGGCGGTGTCGGTGGATCTGGCATGGGTAACTA
CCATGGCTACTACTCCTTCCGCGCCTTCAGCCACCAGCGTGTCATCTGCAACGTACCGAGCTGGTCCGACAGGAT
CCTGCGCGTCCGCTACATGCCCTACTCGGCTCCCGAGCTCCGACGGTACAGAAAGATGCTGCTGCCTAAGCCCAA
CTTCGATCGCGAAGGAAACGTCGTCCGCGACCTCTCGTACTGGCTCGGCCTGGTGCTGGCCCTCGGCGGCAGGGG
TATGAAGTCGATTGCAGTTCGGTGGGGGGTCCTCATTGCCGTGGCTCTCGGGCTGGGGCTGGGAAGAAGGTTTTC
CTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail