Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02109
Gene name
Locationscaffold_02:2622426..2623102
Strand-
Gene length (bp)676
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0645 0.0606 0.8894 0.4558 0.1112 0.0039 0.2263 0.1198 0.224 0.0058

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999742

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1797
Ophiocordyceps australis map64 (Brazil) OphauB2|5259
Ophiocordyceps camponoti-floridani Ophcf2|02109 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1786
Ophiocordyceps kimflemingae Ophio5|3921
Ophiocordyceps subramaniannii Hirsu2|5108

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02109
MKLLLPLTLLATVAGVSAQNEKCDADYIVQACLKSENAKVQMCPGADWDCLCAAYNAVATCYNNCPDNASAPSAR
QAASSNCQQASLYGTKAKAPKTSSMSGSSTSDMTATATVTDSASSTDGSSGSNRAATSFTTGTARPSSTGAASTL
SGSAGGLFVAVAGVLAALL*
Coding >Ophcf2|02109
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCCACCGTCGCCGGCGTCTCTGCTCAGAACGAAAAGTGCGATGCC
GACTACATCGTACAAGCCTGTCTGAAGTCGGAGAATGCAAAGGTCCAGATGTGCCCTGGTGCCGACTGGGACTGC
CTCTGCGCCGCCTACAACGCCGTGGCCACATGCTACAACAACTGCCCCGACAACGCCAGCGCCCCCTCGGCTCGT
CAAGCCGCCAGCAGCAATTGCCAGCAGGCCTCGCTGTACGGCACCAAGGCCAAGGCCCCCAAGACGTCCTCCATG
TCCGGCTCGTCCACCTCTGACATGACGGCCACCGCCACCGTCACCGACTCTGCCTCTTCCACCGACGGCTCCAGT
GGCTCCAACCGAGCCGCTACCTCCTTCACCACTGGCACCGCCAGGCCCTCTAGCACCGGTGCCGCCTCCACCCTG
TCTGGCAGCGCCGGCGGCCTGTTTGTTGCCGTTGCCGGTGTTCTGGCTGCTCTCCTATAA
Transcript >Ophcf2|02109
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCCACCGTCGCCGGCGTCTCTGCTCAGAACGAAAAGTGCGATGCC
GACTACATCGTACAAGCCTGTCTGAAGTCGGAGAATGCAAAGGTCCAGATGTGCCCTGGTGCCGACTGGGACTGC
CTCTGCGCCGCCTACAACGCCGTGGCCACATGCTACAACAACTGCCCCGACAACGCCAGCGCCCCCTCGGCTCGT
CAAGCCGCCAGCAGCAATTGCCAGCAGGCCTCGCTGTACGGCACCAAGGCCAAGGCCCCCAAGACGTCCTCCATG
TCCGGCTCGTCCACCTCTGACATGACGGCCACCGCCACCGTCACCGACTCTGCCTCTTCCACCGACGGCTCCAGT
GGCTCCAACCGAGCCGCTACCTCCTTCACCACTGGCACCGCCAGGCCCTCTAGCACCGGTGCCGCCTCCACCCTG
TCTGGCAGCGCCGGCGGCCTGTTTGTTGCCGTTGCCGGTGTTCTGGCTGCTCTCCTATAA
Gene >Ophcf2|02109
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCCACCGTCGCCGGCGTCTCTGCTCAGAACGAAAAGTGCGATGCC
GACTACATCGTACAAGCCTGTCTGAAGTCGGAGAATGCAAAGGTATCAACATCTTAACCTACCTATCCTACCTAC
CTACCCAATTCCTACGTTCCCACCCCATCACATTCCCATCTCCTCTCCTCGCTGACACTCTCGCCCTTTAGGTCC
AGATGTGCCCTGGTGCCGACTGGGACTGCCTCTGCGCCGCCTACAACGCCGTGGCCACGTACGTTTCCCCCCTTC
CTTCTCTTTGCACCTCTCCCCCCCCCAACTTACACGCCAATCCAGATGCTACAACAACTGCCCCGACAACGCCAG
CGCCCCCTCGGCTCGTCAAGCCGCCAGCAGCAATTGCCAGCAGGCCTCGCTGTACGGCACCAAGGCCAAGGCCCC
CAAGACGTCCTCCATGTCCGGCTCGTCCACCTCTGACATGACGGCCACCGCCACCGTCACCGACTCTGCCTCTTC
CACCGACGGCTCCAGTGGCTCCAACCGAGCCGCTACCTCCTTCACCACTGGCACCGCCAGGCCCTCTAGCACCGG
TGCCGCCTCCACCCTGTCTGGCAGCGCCGGCGGCCTGTTTGTTGCCGTTGCCGGTGTTCTGGCTGCTCTCCTATA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail