Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02093
Gene name
Locationscaffold_02:2584301..2584970
Strand+
Gene length (bp)669
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1253 0.1227 0.9209 0.0477 0.1203 0.032 0.202 0.2656 0.0837 0.0572

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999653

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6977
Ophiocordyceps australis map64 (Brazil) OphauB2|4294
Ophiocordyceps camponoti-floridani Ophcf2|02081
Ophiocordyceps camponoti-floridani Ophcf2|02093 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07411
Ophiocordyceps camponoti-rufipedis Ophun1|2531
Ophiocordyceps camponoti-rufipedis Ophun1|730
Ophiocordyceps kimflemingae Ophio5|508
Ophiocordyceps kimflemingae Ophio5|8326
Ophiocordyceps subramaniannii Hirsu2|10709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02093
MKMHLVLSSLLVGSLASAQVKTNQSRPFHLVIHSGNRQINGMAFTACHTGAGIESLCIFRGSGSEFHFQSSASLE
PPLKDYEPLGLLVWNLPIDPNPYSEAMTLSFEPSSNVALPLFQPSSSPLYVTFDKQDHLSIISYTDDRSSPPVTG
KVRALKNWYLCRTYYSSYTYRTLTWVFGDGMAKPQNPSCIKIDVRRRYLGAVMGS*
Coding >Ophcf2|02093
ATGAAGATGCATCTTGTCCTCTCCTCGCTGCTAGTCGGCAGCCTGGCCTCTGCACAGGTCAAGACGAATCAGTCT
CGGCCCTTTCACTTGGTCATTCATTCTGGTAACCGGCAGATCAATGGCATGGCGTTTACGGCTTGTCACACGGGA
GCAGGCATAGAGTCTCTCTGCATCTTTAGAGGAAGCGGCTCTGAGTTTCACTTTCAAAGCTCGGCAAGTCTCGAG
CCTCCGCTGAAGGACTACGAGCCTCTCGGGCTGCTGGTGTGGAATCTGCCCATCGACCCGAATCCCTACTCCGAA
GCCATGACCTTGTCCTTCGAACCCTCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTCGCCTCTATAC
GTCACCTTCGATAAGCAGGATCATCTATCCATCATCAGCTACACAGACGACAGAAGCAGCCCCCCCGTGACTGGA
AAGGTGCGGGCGCTGAAAAACTGGTACCTATGCCGAACGTATTACTCGAGTTATACCTACCGGACCTTGACCTGG
GTCTTTGGCGATGGAATGGCGAAGCCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTCGGG
GCTGTGATGGGGAGCTGA
Transcript >Ophcf2|02093
ATGAAGATGCATCTTGTCCTCTCCTCGCTGCTAGTCGGCAGCCTGGCCTCTGCACAGGTCAAGACGAATCAGTCT
CGGCCCTTTCACTTGGTCATTCATTCTGGTAACCGGCAGATCAATGGCATGGCGTTTACGGCTTGTCACACGGGA
GCAGGCATAGAGTCTCTCTGCATCTTTAGAGGAAGCGGCTCTGAGTTTCACTTTCAAAGCTCGGCAAGTCTCGAG
CCTCCGCTGAAGGACTACGAGCCTCTCGGGCTGCTGGTGTGGAATCTGCCCATCGACCCGAATCCCTACTCCGAA
GCCATGACCTTGTCCTTCGAACCCTCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTCGCCTCTATAC
GTCACCTTCGATAAGCAGGATCATCTATCCATCATCAGCTACACAGACGACAGAAGCAGCCCCCCCGTGACTGGA
AAGGTGCGGGCGCTGAAAAACTGGTACCTATGCCGAACGTATTACTCGAGTTATACCTACCGGACCTTGACCTGG
GTCTTTGGCGATGGAATGGCGAAGCCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTCGGG
GCTGTGATGGGGAGCTGA
Gene >Ophcf2|02093
ATGAAGATGCATCTTGTCCTCTCCTCGCTGCTAGTCGGCAGCCTGGCCTCTGCACAGGTCAAGACGAATCAGTCT
CGGCCCTTTCACTTGGTCATTCATTCTGGTAACCGGCAGATCAATGGCATGGCGTTTACGGCTTGTCACACGGGA
GCAGGCATAGAGTCTCTCTGCATCTTTAGAGGAAGCGGCTCTGAGTTTCACTTTCAAAGCTCGGCAAGTCTCGAG
CCTCCGCTGAAGGACTACGAGCCTCTCGGGCTGCTGGTGTGGAATCTGCCCATCGGTAAAGACGGTCCGGCCTCA
ACGAGACGATGGACCTAACGTTCCTCAACAGACCCGAATCCCTACTCCGAAGCCATGACCTTGTCCTTCGAACCC
TCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTCGCCTCTATACGTCACCTTCGATAAGCAGGATCAT
CTATCCATCATCAGCTACACAGACGACAGAAGCAGCCCCCCCGTGACTGGAAAGGTGCGGGCGCTGAAAAACTGG
TACCTATGCCGAACGTATTACTCGAGTTATACCTACCGGACCTTGACCTGGGTCTTTGGCGATGGAATGGCGAAG
CCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTCGGGGCTGTGATGGGGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail