Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02090
Gene name
Locationscaffold_02:2576149..2577792
Strand-
Gene length (bp)1643
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 1.1E-06 39 55
PF00098 zf-CCHC Zinc knuckle 2.2E-04 60 75
PF00098 zf-CCHC Zinc knuckle 7.7E-05 81 97
PF00098 zf-CCHC Zinc knuckle 1.9E-04 231 246
PF00098 zf-CCHC Zinc knuckle 6.8E-06 258 274
PF00098 zf-CCHC Zinc knuckle 4.0E-05 281 295
PF00098 zf-CCHC Zinc knuckle 6.3E-08 305 321
PF00098 zf-CCHC Zinc knuckle 2.7E-06 325 342
PF00098 zf-CCHC Zinc knuckle 8.6E-07 350 366
PF14392 zf-CCHC_4 Zinc knuckle 8.5E-01 40 54
PF14392 zf-CCHC_4 Zinc knuckle 2.3E+00 81 96
PF14392 zf-CCHC_4 Zinc knuckle 2.3E-02 228 245
PF14392 zf-CCHC_4 Zinc knuckle 3.2E-01 256 273
PF14392 zf-CCHC_4 Zinc knuckle 1.3E+00 280 296
PF14392 zf-CCHC_4 Zinc knuckle 6.1E+00 326 341

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6713 0.3603 0.0698 0.0746 0.1456 0.0163 0.205 0.1537 0.1592 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4628
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3603
Ophiocordyceps australis map64 (Brazil) OphauB2|5274
Ophiocordyceps camponoti-floridani Ophcf2|02090 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2534
Ophiocordyceps kimflemingae Ophio5|512
Ophiocordyceps subramaniannii Hirsu2|9716

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02090
MLWDNPSTETWGSGTAANEEVADANGAQDVPQGSGDGDKCFSCGETGHRAAECPSPREITCRYCHQPGHMVKDCP
DKPAMVCSNCGQEGHMRNSCTNARKLDRENVATVDPDEAWSKIKTATSERDLDDVKEAVQEYVKACDGAVTYREL
QEGLINEGVNLFLIGVERPLAPVFTNMDLQGNMGKKYSISYRFTEKPGRPREADAFPKNREELLARLDDAGEVVN
SGRSFCHNCGELGHVAKFCTQERTERPEQPKIACTNCGEDGHRLRDCPQPRVDKSACRNCGKSGHRAADCEEPPN
PENVECRKCGEMGHFSRDCPQGGPRGCRNCGGEGHMAKDCDQPRNMELVTCRNCEKTGHMSRDCPEPRDWSKVQC
SNCQKYGHTKVRCQEPPADSDAFQAGGFDAGQDTTSGPVDDSWGNSGSVAVAATDSAGW*
Coding >Ophcf2|02090
ATGCTCTGGGACAACCCCTCGACGGAGACGTGGGGCTCTGGCACCGCGGCCAACGAAGAGGTCGCAGACGCCAAC
GGTGCGCAGGATGTTCCTCAAGGCTCCGGCGACGGGGATAAATGCTTCAGTTGCGGAGAGACTGGACATCGAGCT
GCGGAATGTCCTTCGCCCCGCGAAATAACCTGTCGCTATTGCCATCAACCTGGGCACATGGTAAAGGACTGCCCG
GACAAGCCTGCCATGGTCTGCTCGAACTGCGGCCAAGAAGGCCACATGAGAAATTCCTGCACCAATGCCCGTAAG
CTGGATCGCGAGAATGTCGCCACAGTCGATCCGGACGAGGCCTGGTCCAAGATCAAGACCGCAACCTCCGAGAGA
GACCTCGACGACGTCAAGGAAGCTGTTCAGGAATATGTCAAGGCTTGTGATGGCGCTGTGACGTACCGAGAACTC
CAGGAGGGCCTCATCAACGAGGGCGTCAATCTATTTCTCATCGGCGTCGAACGACCTCTCGCGCCGGTCTTCACG
AACATGGATCTGCAAGGGAACATGGGAAAGAAGTACAGTATCTCGTATCGATTTACTGAAAAGCCCGGGCGTCCT
CGGGAAGCTGATGCGTTCCCCAAGAATCGAGAGGAGCTCCTAGCTCGTCTCGATGACGCGGGTGAAGTTGTGAAC
AGTGGTCGCTCGTTCTGTCACAATTGTGGCGAACTTGGCCACGTGGCCAAATTTTGCACGCAGGAAAGAACCGAG
AGACCGGAGCAACCGAAGATCGCGTGCACGAACTGTGGCGAAGACGGCCATCGTCTTCGAGATTGTCCCCAGCCT
CGCGTTGATAAGTCGGCGTGCCGGAACTGCGGTAAATCTGGTCACCGCGCCGCGGATTGCGAGGAGCCGCCAAAC
CCGGAGAACGTTGAGTGCCGCAAATGCGGCGAGATGGGCCATTTTTCTCGCGACTGTCCTCAGGGAGGTCCTCGC
GGCTGCCGCAACTGTGGCGGAGAGGGCCATATGGCCAAAGACTGCGACCAGCCTCGCAACATGGAGCTCGTTACA
TGCCGCAACTGCGAGAAGACCGGCCATATGAGCCGGGATTGCCCCGAGCCGCGAGACTGGAGCAAAGTCCAGTGC
AGCAACTGCCAGAAATACGGACACACCAAGGTCCGTTGTCAGGAGCCGCCGGCAGACTCGGATGCATTCCAGGCT
GGCGGTTTCGATGCGGGCCAGGATACTACCAGCGGCCCCGTGGACGATTCCTGGGGAAACTCCGGAAGTGTTGCC
GTCGCTGCGACGGACTCGGCTGGCTGGTGA
Transcript >Ophcf2|02090
ATGCTCTGGGACAACCCCTCGACGGAGACGTGGGGCTCTGGCACCGCGGCCAACGAAGAGGTCGCAGACGCCAAC
GGTGCGCAGGATGTTCCTCAAGGCTCCGGCGACGGGGATAAATGCTTCAGTTGCGGAGAGACTGGACATCGAGCT
GCGGAATGTCCTTCGCCCCGCGAAATAACCTGTCGCTATTGCCATCAACCTGGGCACATGGTAAAGGACTGCCCG
GACAAGCCTGCCATGGTCTGCTCGAACTGCGGCCAAGAAGGCCACATGAGAAATTCCTGCACCAATGCCCGTAAG
CTGGATCGCGAGAATGTCGCCACAGTCGATCCGGACGAGGCCTGGTCCAAGATCAAGACCGCAACCTCCGAGAGA
GACCTCGACGACGTCAAGGAAGCTGTTCAGGAATATGTCAAGGCTTGTGATGGCGCTGTGACGTACCGAGAACTC
CAGGAGGGCCTCATCAACGAGGGCGTCAATCTATTTCTCATCGGCGTCGAACGACCTCTCGCGCCGGTCTTCACG
AACATGGATCTGCAAGGGAACATGGGAAAGAAGTACAGTATCTCGTATCGATTTACTGAAAAGCCCGGGCGTCCT
CGGGAAGCTGATGCGTTCCCCAAGAATCGAGAGGAGCTCCTAGCTCGTCTCGATGACGCGGGTGAAGTTGTGAAC
AGTGGTCGCTCGTTCTGTCACAATTGTGGCGAACTTGGCCACGTGGCCAAATTTTGCACGCAGGAAAGAACCGAG
AGACCGGAGCAACCGAAGATCGCGTGCACGAACTGTGGCGAAGACGGCCATCGTCTTCGAGATTGTCCCCAGCCT
CGCGTTGATAAGTCGGCGTGCCGGAACTGCGGTAAATCTGGTCACCGCGCCGCGGATTGCGAGGAGCCGCCAAAC
CCGGAGAACGTTGAGTGCCGCAAATGCGGCGAGATGGGCCATTTTTCTCGCGACTGTCCTCAGGGAGGTCCTCGC
GGCTGCCGCAACTGTGGCGGAGAGGGCCATATGGCCAAAGACTGCGACCAGCCTCGCAACATGGAGCTCGTTACA
TGCCGCAACTGCGAGAAGACCGGCCATATGAGCCGGGATTGCCCCGAGCCGCGAGACTGGAGCAAAGTCCAGTGC
AGCAACTGCCAGAAATACGGACACACCAAGGTCCGTTGTCAGGAGCCGCCGGCAGACTCGGATGCATTCCAGGCT
GGCGGTTTCGATGCGGGCCAGGATACTACCAGCGGCCCCGTGGACGATTCCTGGGGAAACTCCGGAAGTGTTGCC
GTCGCTGCGACGGACTCGGCTGGCTGGTGA
Gene >Ophcf2|02090
ATGCTCTGGGACAACCCCTCGACGGAGACGTGGGGCTCTGGCACCGCGGCCAACGAAGAGGTCGCAGACGCCAAC
GGTGCGCAGGATGTTCCTCAAGGCTCCGGCGACGGGGATAAATGCTTCAGTTGCGGAGAGACTGGGTAGGTCCTA
GAGCAAACCCGAGTAAAGCTCGCGTTACTGACTTCCCACCAGACATCGAGCTGCGGAATGTCCTTCGCCCCGCGA
AATAACCTGTCGCTATTGCCATCAACCTGGGCACATGGTAAAGGACTGCCCGGACAAGCCTGCCATGGTCTGCTC
GAACTGCGGCCAAGAAGGTAAGCTTCGTCGATGCGGGAACCGTGCACTACGAAGATTCCCTTCCGCTGACGAGCT
TCATCAGGCCACATGAGAAATTCCTGCACCAATGCCCGTAAGCTGGATCGCGAGAATGTCGCCACAGTCGATCCG
GACGAGGCCTGGTCCAAGATCAAGACCGCAACCTCCGAGAGAGACCTCGACGACGTCAAGGAAGCTGTTCAGGAA
TATGTCAAGGCTTGTGATGGCGCTGTGACGTACCGAGAACTCCAGGAGGGCCTCATCAACGAGGGCGTCAATCTA
TTTCTCATCGGCGTCGAACGACCTCTCGCGCCGGTCTTCACGAACATGGATCTGCAAGGGAACATGGGAAAGAAG
TACAGTATCTCGTATCGATTTACTGAAAAGCCCGGGCGTCCTCGGGAAGCTGATGCGTTCCCCAAGAATCGAGAG
GAGCTCCTAGCTCGTCTCGATGACGCGGGTGAAGTTGTGAACAGTGGTCGCTCGTTCTGTCACAATTGTGGCGAA
CTTGGCCACGTGGCCAAATTTTGCACGCAGGAAAGAACCGAGAGACCGGAGCAACCGAAGATCGCGTGCACGAAC
TGTGGCGAAGACGGCCATCGTCTTCGAGATTGTATGACAGCTATTTCCACCCCCCCAGACCCGAGTTCAAGCTGA
CATGTTTCTTTCTAGGTCCCCAGCCTCGCGTTGATAAGTCGGCGTGCCGGAACTGCGGGTATGTCAAAGTCCCTT
GGCTTCTCGTGTGCGATGCTTGCTGACATTTATGGCAGTAAATCTGGTCACCGCGCCGCGGATTGCGAGGAGCCG
CCAAACCCGGAGAACGTTGAGTGCCGCAAATGCGGCGAGAGTGAGTCTGCCCCGTCATGTGCCTCTCTCCCATAC
ATGTGCTGATGCTGCGAAGTGGGCCATTTTTCTCGCGACTGTCCTCAGGGAGGTCCTCGCGGCTGCCGCAACTGT
GGCGGAGAGGGCCATATGGCCAAAGACTGCGACCAGCCTCGCAACATGGAGCTCGTTACATGCCGCAACTGCGAG
AAGACCGGCCATATGAGCCGGGATTGCCCCGAGCCGCGAGACTGTAAGCACAAGCCTTCCCGTCAAGCTGAATTA
ACATGGACTGACATATTGCAGGGAGCAAAGTCCAGTGCAGCAACTGCCAGAAATACGGACACACCAAGGTCCGTT
GTCAGGAGCCGCCGGCAGACTCGGATGCATTCCAGGCTGGCGGTTTCGATGCGGGCCAGGATACTACCAGCGGCC
CCGTGGACGATTCCTGGGGAAACTCCGGAAGTGTTGCCGTCGCTGCGACGGACTCGGCTGGCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail