Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02088
Gene name
Locationscaffold_02:2567728..2568523
Strand+
Gene length (bp)795
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03937 Sdh5 Flavinator of succinate dehydrogenase 2.4E-23 84 145

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.4607 0.4418 0.2141 0.0286 0.5161 0.2825 0.1344 0.0664 0.0554 0.0621

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5134
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3600
Ophiocordyceps australis map64 (Brazil) OphauB2|5277
Ophiocordyceps camponoti-floridani Ophcf2|02088 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7126
Ophiocordyceps kimflemingae Ophio5|4597
Ophiocordyceps subramaniannii Hirsu2|3490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02088
MSLYISTYTHYIYPQLSLKSQPQQSAHHDNPKTPPPRLHPLHPPILPLEILILSPQQPPPEQSEATIRIKPIQRT
DEDDTTKRARLLYQSRKRGTLESDLVLSSFAASHLASLTPPQLNQYDQLLDENDWDIYYWATQPSEPDADATTLR
ETPPTPPSSTEWPGAAAGSFRPAFRPVPPRWRDSDILRLLREHVASRSGGRGAGLAFMPPLDDKSPPG*
Coding >Ophcf2|02088
ATGTCACTATACATATCTACATACACCCACTATATATACCCTCAACTCTCACTCAAGAGTCAACCCCAACAATCA
GCCCATCATGACAACCCCAAGACTCCTCCTCCGCGCCTCCACCCGCTTCACCCCCCGATCCTCCCGCTGGAAATC
CTCATCCTCTCTCCCCAGCAACCCCCCCCCGAACAATCCGAAGCCACGATCCGCATCAAACCCATCCAACGCACC
GACGAAGACGACACCACAAAACGAGCCCGCCTCCTCTATCAATCTCGAAAACGCGGAACCCTCGAATCAGACCTC
GTCCTCTCCTCCTTCGCAGCCTCCCACCTCGCATCCCTGACACCCCCCCAACTAAACCAGTACGACCAGCTCCTC
GACGAAAACGACTGGGACATCTACTACTGGGCCACCCAGCCCTCCGAACCGGATGCCGACGCCACAACCCTGCGC
GAGACGCCGCCGACACCCCCGTCGTCGACGGAGTGGCCCGGGGCGGCCGCCGGGTCTTTCCGGCCTGCCTTCCGG
CCAGTGCCTCCTCGCTGGCGGGATTCTGATATTCTTCGCTTGTTGAGGGAGCATGTCGCTTCGCGGTCAGGTGGG
CGTGGTGCTGGATTGGCCTTTATGCCGCCGCTGGATGATAAGTCTCCTCCTGGTTGA
Transcript >Ophcf2|02088
ATGTCACTATACATATCTACATACACCCACTATATATACCCTCAACTCTCACTCAAGAGTCAACCCCAACAATCA
GCCCATCATGACAACCCCAAGACTCCTCCTCCGCGCCTCCACCCGCTTCACCCCCCGATCCTCCCGCTGGAAATC
CTCATCCTCTCTCCCCAGCAACCCCCCCCCGAACAATCCGAAGCCACGATCCGCATCAAACCCATCCAACGCACC
GACGAAGACGACACCACAAAACGAGCCCGCCTCCTCTATCAATCTCGAAAACGCGGAACCCTCGAATCAGACCTC
GTCCTCTCCTCCTTCGCAGCCTCCCACCTCGCATCCCTGACACCCCCCCAACTAAACCAGTACGACCAGCTCCTC
GACGAAAACGACTGGGACATCTACTACTGGGCCACCCAGCCCTCCGAACCGGATGCCGACGCCACAACCCTGCGC
GAGACGCCGCCGACACCCCCGTCGTCGACGGAGTGGCCCGGGGCGGCCGCCGGGTCTTTCCGGCCTGCCTTCCGG
CCAGTGCCTCCTCGCTGGCGGGATTCTGATATTCTTCGCTTGTTGAGGGAGCATGTCGCTTCGCGGTCAGGTGGG
CGTGGTGCTGGATTGGCCTTTATGCCGCCGCTGGATGATAAGTCTCCTCCTGGTTGA
Gene >Ophcf2|02088
ATGTCACTATACATATCTACATACACCCACTATATATGTAGGTACGTATTGCCCCCGATCCTCCCTCGCCCCAGA
ATCTTAGTAAACCTCTGACCACCATCCCCAGACCCTCAACTCTCACTCAAGAGTCAACCCCAACAATCAGCCCAT
CATGACAACCCCAAGACTCCTCCTCCGCGCCTCCACCCGCTTCACCCCCCGATCCTCCCGCTGGAAATCCTCATC
CTCTCTCCCCAGCAACCCCCCCCCGAACAATCCGAAGCCACGATCCGCATCAAACCCATCCAACGCACCGACGAA
GACGACACCACAAAACGAGCCCGCCTCCTCTGTAAGCATGCATCCATCAACCCCCTCCCGTTCAATCGCAAACTA
ACATTCCCTCCCCCCCTCCCCAAAGATCAATCTCGAAAACGCGGAACCCTCGAATCAGACCTCGTCCTCTCCTCC
TTCGCAGCCTCCCACCTCGCATCCCTGACACCCCCCCAACTAAACCAGTACGACCAGCTCCTCGACGAAAACGAC
TGGGACATCTACTACTGGGCCACCCAGCCCTCCGAACCGGATGCCGACGCCACAACCCTGCGCGAGACGCCGCCG
ACACCCCCGTCGTCGACGGAGTGGCCCGGGGCGGCCGCCGGGTCTTTCCGGCCTGCCTTCCGGCCAGTGCCTCCT
CGCTGGCGGGATTCTGATATTCTTCGCTTGTTGAGGGAGCATGTCGCTTCGCGGTCAGGTGGGCGTGGTGCTGGA
TTGGCCTTTATGCCGCCGCTGGATGATAAGTCTCCTCCTGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail