Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02078
Gene name
Locationscaffold_02:2547518..2548284
Strand-
Gene length (bp)766
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00962 A_deaminase Adenosine deaminase 4.9E-19 48 189

GO

GO Term Description Terminal node
GO:0019239 deaminase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6609 0.4128 0.2688 0.1755 0.1107 0.0146 0.0547 0.2214 0.0492 0.0116

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6520
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02078 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07414
Ophiocordyceps kimflemingae Ophio5|3915
Ophiocordyceps subramaniannii Hirsu2|1176

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02078
MKLALERKQKFPHLFSGYDVVSQEDLGRSLSDMTPELLWFQQQAQSLNLSIPFFFHAGETLGSGNSTDSNLLDAL
LLGTRRIGHGFSLYKHPSLIQRAVADGVMVEVCPVSNEVLRLATDILHHPLPALVAHGVPTSISNDDPAMLGQDA
AGLSYDFFQVIQAFDNVGLAGLGALAHNSLRWSHLEDQSDADWKRDIELAERGGGIKAQRLREWNIQWEKYCRWV
VREFGS*
Coding >Ophcf2|02078
ATGAAACTCGCCCTCGAGAGAAAACAAAAGTTTCCCCATCTCTTCAGCGGCTACGACGTCGTCTCGCAAGAAGAT
CTCGGCCGCAGCCTCTCGGACATGACGCCCGAACTACTCTGGTTCCAACAGCAAGCCCAATCCCTCAACCTCTCC
ATCCCCTTCTTCTTCCACGCGGGCGAGACGCTGGGCTCCGGCAACTCCACCGACTCGAACCTGCTGGACGCGCTG
CTCCTCGGAACGCGCCGCATCGGCCACGGCTTCTCGCTGTACAAGCATCCGAGTTTGATCCAGAGGGCCGTCGCC
GATGGCGTCATGGTGGAGGTCTGTCCTGTTTCCAACGAGGTTCTTCGCCTGGCCACGGACATTCTTCACCATCCG
CTGCCGGCGCTCGTTGCTCATGGGGTTCCGACGTCGATTAGCAACGATGATCCGGCGATGCTGGGACAGGACGCT
GCTGGCCTCAGCTACGATTTCTTCCAGGTCATCCAGGCGTTTGATAACGTCGGTTTGGCTGGTCTGGGGGCGCTT
GCGCATAATAGTCTGCGATGGTCTCACCTTGAGGACCAGTCTGATGCCGACTGGAAGAGGGATATTGAACTGGCG
GAACGAGGCGGTGGCATCAAGGCTCAGCGGCTGCGGGAGTGGAATATCCAATGGGAGAAGTATTGTCGCTGGGTT
GTCAGGGAGTTTGGCTCATAG
Transcript >Ophcf2|02078
ATGAAACTCGCCCTCGAGAGAAAACAAAAGTTTCCCCATCTCTTCAGCGGCTACGACGTCGTCTCGCAAGAAGAT
CTCGGCCGCAGCCTCTCGGACATGACGCCCGAACTACTCTGGTTCCAACAGCAAGCCCAATCCCTCAACCTCTCC
ATCCCCTTCTTCTTCCACGCGGGCGAGACGCTGGGCTCCGGCAACTCCACCGACTCGAACCTGCTGGACGCGCTG
CTCCTCGGAACGCGCCGCATCGGCCACGGCTTCTCGCTGTACAAGCATCCGAGTTTGATCCAGAGGGCCGTCGCC
GATGGCGTCATGGTGGAGGTCTGTCCTGTTTCCAACGAGGTTCTTCGCCTGGCCACGGACATTCTTCACCATCCG
CTGCCGGCGCTCGTTGCTCATGGGGTTCCGACGTCGATTAGCAACGATGATCCGGCGATGCTGGGACAGGACGCT
GCTGGCCTCAGCTACGATTTCTTCCAGGTCATCCAGGCGTTTGATAACGTCGGTTTGGCTGGTCTGGGGGCGCTT
GCGCATAATAGTCTGCGATGGTCTCACCTTGAGGACCAGTCTGATGCCGACTGGAAGAGGGATATTGAACTGGCG
GAACGAGGCGGTGGCATCAAGGCTCAGCGGCTGCGGGAGTGGAATATCCAATGGGAGAAGTATTGTCGCTGGGTT
GTCAGGGAGTTTGGCTCATAG
Gene >Ophcf2|02078
ATGAAACTCGCCCTCGAGAGAAAACAAAAGTTTCCCCATCTCTTCAGCGGCTACGACGTCGTCTCGCAAGAAGAT
CTCGGCCGCAGCCTCTCGGACATGACGCCCGAACTACTCTGGTTCCAACAGCAAGCCCAATCCCTCAACCTCTCC
ATCCCCTTCTTCTTCCACGCGGGCGAGACGCTGGGCTCCGGCAACTCCACCGACTCGAACCTGCTGGACGCGCTG
CTCCTCGGAACGCGCCGCATCGGCCACGGCTTCTCGCTGTACAAGCATCCGAGTTTGATCCAGAGGGCCGTCGCC
GATGGCGTCATGGTGGAGGTCTGTCCTGTTTCCAACGAGGTTCTTCGCCTGGCCACGGACATTCTTCACCATCCG
CTGCCGGCGCTCGTTGCTCATGGGGTTCCGACGTCGATTAGCAACGATGATCCGGCGATGCTGGGACAGGACGCT
GCTGGCCTCAGCTACGATTTCTTCCAGGTCATCCAGGCGTTTGATAACGTCGGTTTGGCTGGTCTGGTTCGTTTC
TTTTTCGTCTTGATGCTTGCTGAGTTTACCGGGTTGGTTGCTGACGGCGTGTCTTGAAAAGGGGGCGCTTGCGCA
TAATAGTCTGCGATGGTCTCACCTTGAGGACCAGTCTGATGCCGACTGGAAGAGGGATATTGAACTGGCGGAACG
AGGCGGTGGCATCAAGGCTCAGCGGCTGCGGGAGTGGAATATCCAATGGGAGAAGTATTGTCGCTGGGTTGTCAG
GGAGTTTGGCTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail