Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02059
Gene name
Locationscaffold_02:2499451..2502314
Strand+
Gene length (bp)2863
Transcript length (bp)2757
Coding sequence length (bp)2757
Protein length (aa) 919

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 3.2E-68 225 393
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.3E-26 146 224
PF03142 Chitin_synth_2 Chitin synthase 5.8E-21 370 579

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0016758 hexosyltransferase activity No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0006022 aminoglycan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006030 chitin metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0006040 amino sugar metabolic process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 571 593 22
2 631 653 22
3 663 685 22
4 710 732 22
5 747 769 22
6 842 864 22
7 884 906 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02059
MAYNGPGQGHAYGGGGHPMQDLPAGGNYHHMPTHEPDDDAGRYLLNDPPAVGFDNDRLGARTPPVRPVSAYSLTE
SYAPGASQLPQQNTGGGGFGVNSYGQYPQAAGYDYDRPANNVHDEEESWMLRQQQPGGFSRAGTGLKRYHTRRVK
LVQGSVLSIDYPVPSAIKNAVQPLYRDVEGGNEEFMKMRYTAATCDPNDFTLKNGYDLRPRMYNRHTELLIAITY
YNEDKVLLSRTLHGVMQNIRDIVNLKKSTFWNKGGPAWQKIVVCLVFDGIEKADKNTLDVLATVGVYQDGVIKKD
VDGKETVAHIFEYTSQLSVTPNQQLIRPKDDSPQNLPPVQFIFCLKQKNSKKINSHRWLFNAFGRILNPEVTILI
DAGTKPGPRSLLALWEGFYNDKDLGGACGEIHAMLGKGGKKLLNPLVAVQNFEYKISNILDKPLESSFGYVSVLP
GAFSAYRFRAIMGRPLEQYFHGDHTLSKILGKKGIDGMNIFKKNMFLAEDRILCFELVAKAGQKWHLTYIKAAKG
ETDVPEGAPEFISQRRRWLNGSFAASLYSLMHFGRIYKSGHNIIRMFFFHIQLIYNFLNLVFSWFSLASYYLTTT
VIMDLVGTPVVASDSASEHHGWPFGDTATPIVNALLKYLYLAFVILQFILALGNRPKGSKFTYIASFMLFGLIQG
YILVLSGYLVARAFNTPLAKQISLASGGDFVRSFFIGSGAAGVILIALITIYGLYFIASFLYLDPWHMFHSFPSY
MILMSTYINILMVYAFNNWHDVSWGTKGSDASDALPSANITKGEKNEAVVEEIEKEQEDIDSQFEQTVRRALAPF
KEADEDEKKDVEDGYKSFRTGLVVSWLFSNILLVIVITSDNFNSFGIGKSASVRTANFFKFLLYATAVLSLIRFF
GFLWYLGRTGIMCCFARR*
Coding >Ophcf2|02059
ATGGCGTACAACGGCCCGGGCCAGGGCCATGCGTATGGCGGTGGAGGACACCCGATGCAGGACCTCCCCGCTGGC
GGCAACTATCATCACATGCCTACCCATGAGCCAGACGACGATGCGGGCCGCTATCTGCTCAACGACCCGCCCGCC
GTCGGCTTCGACAACGACCGGCTCGGAGCCCGAACGCCCCCCGTCCGGCCCGTTTCCGCCTATAGCCTCACGGAG
TCGTACGCGCCGGGGGCCTCCCAGCTGCCCCAGCAAAACACCGGAGGCGGCGGCTTCGGCGTCAATTCTTACGGC
CAGTACCCTCAGGCCGCCGGCTACGACTACGATCGCCCGGCAAACAACGTCCATGACGAAGAGGAGAGCTGGATG
CTCCGTCAGCAGCAGCCCGGCGGCTTCAGCCGTGCTGGCACCGGCCTCAAGCGCTATCACACCAGGCGCGTCAAG
CTTGTGCAAGGCTCCGTCCTGAGCATCGACTATCCCGTCCCCAGTGCCATCAAGAACGCCGTTCAGCCGCTGTAC
CGCGATGTCGAGGGCGGCAACGAGGAGTTCATGAAGATGCGTTACACGGCCGCCACCTGCGACCCCAACGACTTC
ACCCTCAAGAACGGTTACGATTTGCGGCCCCGCATGTATAACAGACATACCGAGCTGCTCATCGCCATCACCTAC
TACAACGAGGACAAGGTCTTGCTCTCCCGTACCCTGCACGGCGTCATGCAAAATATCCGTGACATCGTCAACCTC
AAAAAGTCGACCTTTTGGAACAAGGGCGGACCCGCGTGGCAAAAGATTGTCGTCTGTCTCGTCTTCGACGGCATC
GAAAAGGCCGACAAGAACACGCTCGACGTGCTCGCCACCGTTGGCGTCTACCAGGACGGCGTCATCAAAAAGGAT
GTCGACGGCAAGGAGACGGTCGCCCACATCTTCGAGTACACCAGCCAGCTGTCCGTGACGCCCAACCAGCAGCTC
ATCCGCCCCAAGGACGATAGCCCGCAAAACCTGCCGCCCGTGCAGTTCATCTTCTGCCTCAAGCAGAAGAACAGC
AAGAAGATCAACTCGCACCGCTGGCTCTTCAATGCCTTTGGCCGCATCCTCAACCCAGAGGTCACCATCCTCATC
GATGCCGGCACCAAGCCCGGCCCCCGCTCGCTGCTGGCCCTATGGGAGGGCTTCTACAACGACAAGGACCTCGGC
GGCGCCTGCGGCGAGATTCACGCCATGCTGGGCAAGGGCGGCAAGAAGCTGCTCAATCCGCTGGTGGCAGTGCAG
AACTTTGAGTACAAAATCTCAAACATCCTCGACAAGCCGCTCGAGAGCTCGTTTGGCTACGTCAGCGTTCTGCCC
GGTGCCTTCTCGGCGTACCGCTTCCGCGCAATCATGGGTCGGCCGTTGGAGCAGTACTTCCACGGCGACCACACG
CTGTCCAAGATCCTGGGCAAGAAGGGCATCGACGGCATGAACATCTTCAAAAAGAACATGTTCCTCGCCGAGGAC
CGCATCCTGTGCTTCGAGCTCGTCGCAAAGGCCGGCCAGAAGTGGCACCTGACGTACATCAAGGCGGCCAAGGGC
GAGACGGATGTGCCCGAGGGCGCGCCCGAGTTCATCAGCCAGCGTCGGCGCTGGCTCAACGGCTCTTTTGCCGCC
TCGCTCTATTCGCTCATGCACTTTGGTCGTATCTACAAGAGTGGCCACAACATCATCCGCATGTTCTTCTTCCAC
ATTCAGCTCATCTACAACTTCCTCAACCTCGTCTTCTCATGGTTCTCGCTGGCGTCGTACTACCTGACGACGACG
GTCATCATGGACCTGGTCGGCACCCCCGTCGTCGCCTCTGACTCGGCCTCTGAGCACCACGGTTGGCCCTTTGGC
GACACGGCGACGCCCATCGTCAACGCGCTGCTCAAGTACCTTTACCTGGCCTTTGTCATCCTGCAGTTCATCCTG
GCGCTCGGCAACCGACCCAAGGGCTCCAAGTTTACGTACATTGCGTCTTTCATGCTCTTCGGCCTCATCCAGGGC
TACATTCTGGTGCTGTCGGGCTACTTGGTGGCGCGGGCCTTTAACACTCCCCTGGCCAAGCAAATCTCTCTCGCG
TCGGGCGGCGACTTCGTCCGCAGTTTCTTCATCGGATCCGGGGCAGCGGGCGTGATCTTGATTGCACTCATCACG
ATCTACGGGCTCTACTTTATCGCGTCCTTCTTGTACCTGGACCCCTGGCACATGTTCCACTCGTTCCCGTCCTAC
ATGATCCTCATGTCGACGTACATCAACATCCTGATGGTCTATGCCTTCAACAACTGGCACGACGTCTCGTGGGGT
ACGAAAGGCTCCGACGCATCGGACGCGCTGCCGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGCGGTGGTT
GAGGAAATTGAGAAGGAGCAGGAGGACATCGACAGCCAGTTTGAGCAGACGGTGCGTCGTGCTCTGGCGCCCTTT
AAGGAGGCGGACGAGGATGAGAAGAAGGACGTCGAGGATGGGTACAAGTCTTTCCGGACGGGCCTGGTCGTCTCC
TGGCTCTTCTCCAACATTTTGCTCGTCATCGTTATTACCAGCGACAACTTTAATTCGTTTGGCATCGGAAAATCG
GCATCGGTCCGCACGGCCAACTTTTTCAAGTTTCTGCTGTACGCCACGGCGGTGCTGTCGCTGATCCGCTTCTTC
GGCTTCCTTTGGTACCTGGGTAGGACGGGCATCATGTGCTGCTTTGCGCGGAGATGA
Transcript >Ophcf2|02059
ATGGCGTACAACGGCCCGGGCCAGGGCCATGCGTATGGCGGTGGAGGACACCCGATGCAGGACCTCCCCGCTGGC
GGCAACTATCATCACATGCCTACCCATGAGCCAGACGACGATGCGGGCCGCTATCTGCTCAACGACCCGCCCGCC
GTCGGCTTCGACAACGACCGGCTCGGAGCCCGAACGCCCCCCGTCCGGCCCGTTTCCGCCTATAGCCTCACGGAG
TCGTACGCGCCGGGGGCCTCCCAGCTGCCCCAGCAAAACACCGGAGGCGGCGGCTTCGGCGTCAATTCTTACGGC
CAGTACCCTCAGGCCGCCGGCTACGACTACGATCGCCCGGCAAACAACGTCCATGACGAAGAGGAGAGCTGGATG
CTCCGTCAGCAGCAGCCCGGCGGCTTCAGCCGTGCTGGCACCGGCCTCAAGCGCTATCACACCAGGCGCGTCAAG
CTTGTGCAAGGCTCCGTCCTGAGCATCGACTATCCCGTCCCCAGTGCCATCAAGAACGCCGTTCAGCCGCTGTAC
CGCGATGTCGAGGGCGGCAACGAGGAGTTCATGAAGATGCGTTACACGGCCGCCACCTGCGACCCCAACGACTTC
ACCCTCAAGAACGGTTACGATTTGCGGCCCCGCATGTATAACAGACATACCGAGCTGCTCATCGCCATCACCTAC
TACAACGAGGACAAGGTCTTGCTCTCCCGTACCCTGCACGGCGTCATGCAAAATATCCGTGACATCGTCAACCTC
AAAAAGTCGACCTTTTGGAACAAGGGCGGACCCGCGTGGCAAAAGATTGTCGTCTGTCTCGTCTTCGACGGCATC
GAAAAGGCCGACAAGAACACGCTCGACGTGCTCGCCACCGTTGGCGTCTACCAGGACGGCGTCATCAAAAAGGAT
GTCGACGGCAAGGAGACGGTCGCCCACATCTTCGAGTACACCAGCCAGCTGTCCGTGACGCCCAACCAGCAGCTC
ATCCGCCCCAAGGACGATAGCCCGCAAAACCTGCCGCCCGTGCAGTTCATCTTCTGCCTCAAGCAGAAGAACAGC
AAGAAGATCAACTCGCACCGCTGGCTCTTCAATGCCTTTGGCCGCATCCTCAACCCAGAGGTCACCATCCTCATC
GATGCCGGCACCAAGCCCGGCCCCCGCTCGCTGCTGGCCCTATGGGAGGGCTTCTACAACGACAAGGACCTCGGC
GGCGCCTGCGGCGAGATTCACGCCATGCTGGGCAAGGGCGGCAAGAAGCTGCTCAATCCGCTGGTGGCAGTGCAG
AACTTTGAGTACAAAATCTCAAACATCCTCGACAAGCCGCTCGAGAGCTCGTTTGGCTACGTCAGCGTTCTGCCC
GGTGCCTTCTCGGCGTACCGCTTCCGCGCAATCATGGGTCGGCCGTTGGAGCAGTACTTCCACGGCGACCACACG
CTGTCCAAGATCCTGGGCAAGAAGGGCATCGACGGCATGAACATCTTCAAAAAGAACATGTTCCTCGCCGAGGAC
CGCATCCTGTGCTTCGAGCTCGTCGCAAAGGCCGGCCAGAAGTGGCACCTGACGTACATCAAGGCGGCCAAGGGC
GAGACGGATGTGCCCGAGGGCGCGCCCGAGTTCATCAGCCAGCGTCGGCGCTGGCTCAACGGCTCTTTTGCCGCC
TCGCTCTATTCGCTCATGCACTTTGGTCGTATCTACAAGAGTGGCCACAACATCATCCGCATGTTCTTCTTCCAC
ATTCAGCTCATCTACAACTTCCTCAACCTCGTCTTCTCATGGTTCTCGCTGGCGTCGTACTACCTGACGACGACG
GTCATCATGGACCTGGTCGGCACCCCCGTCGTCGCCTCTGACTCGGCCTCTGAGCACCACGGTTGGCCCTTTGGC
GACACGGCGACGCCCATCGTCAACGCGCTGCTCAAGTACCTTTACCTGGCCTTTGTCATCCTGCAGTTCATCCTG
GCGCTCGGCAACCGACCCAAGGGCTCCAAGTTTACGTACATTGCGTCTTTCATGCTCTTCGGCCTCATCCAGGGC
TACATTCTGGTGCTGTCGGGCTACTTGGTGGCGCGGGCCTTTAACACTCCCCTGGCCAAGCAAATCTCTCTCGCG
TCGGGCGGCGACTTCGTCCGCAGTTTCTTCATCGGATCCGGGGCAGCGGGCGTGATCTTGATTGCACTCATCACG
ATCTACGGGCTCTACTTTATCGCGTCCTTCTTGTACCTGGACCCCTGGCACATGTTCCACTCGTTCCCGTCCTAC
ATGATCCTCATGTCGACGTACATCAACATCCTGATGGTCTATGCCTTCAACAACTGGCACGACGTCTCGTGGGGT
ACGAAAGGCTCCGACGCATCGGACGCGCTGCCGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGCGGTGGTT
GAGGAAATTGAGAAGGAGCAGGAGGACATCGACAGCCAGTTTGAGCAGACGGTGCGTCGTGCTCTGGCGCCCTTT
AAGGAGGCGGACGAGGATGAGAAGAAGGACGTCGAGGATGGGTACAAGTCTTTCCGGACGGGCCTGGTCGTCTCC
TGGCTCTTCTCCAACATTTTGCTCGTCATCGTTATTACCAGCGACAACTTTAATTCGTTTGGCATCGGAAAATCG
GCATCGGTCCGCACGGCCAACTTTTTCAAGTTTCTGCTGTACGCCACGGCGGTGCTGTCGCTGATCCGCTTCTTC
GGCTTCCTTTGGTACCTGGGTAGGACGGGCATCATGTGCTGCTTTGCGCGGAGATGA
Gene >Ophcf2|02059
ATGGCGTACAACGGCCCGGGCCAGGGCCATGCGTATGGCGGTGGAGGACACCCGATGCAGGACCTCCCCGCTGGC
GGCAACGTGAGTCCCGAAACGCGTCTCGAGGACAATGTGTTGACATGACGGCAGTATCATCACATGCCTACCCAT
GAGCCAGACGACGATGCGGGCCGCTATCTGCTCAACGACCCGCCCGCCGTCGGCTTCGACAACGACCGGCTCGGA
GCCCGAACGCCCCCCGTCCGGCCCGTTTCCGCCTATAGCCTCACGGAGTCGTACGCGCCGGGGGCCTCCCAGCTG
CCCCAGCAAAACACCGGAGGCGGCGGCTTCGGCGTCAATTCTTACGGCCAGTACCCTCAGGCCGCCGGCTACGAC
TACGATCGCCCGGCAAACAACGTCCATGACGAAGAGGAGAGCTGGATGCTCCGTCAGCAGCAGCCCGGCGGCTTC
AGCCGTGCTGGCACCGGCCTCAAGCGCTATCACACCAGGCGCGTCAAGCTTGTGCAAGGCTCCGTCCTGAGCATC
GACTATCCCGTCCCCAGTGCCATCAAGAACGCCGTTCAGCCGCTGTACCGCGATGTCGAGGGCGGCAACGAGGAG
TTCATGAAGATGCGTTACACGGCCGCCACCTGCGACCCCAACGACTTCACCCTCAAGAACGGTTACGATTTGCGG
CCCCGCATGTATAACAGACATACCGAGCTGCTCATCGCCATCACCTACTACAACGAGGACAAGGTCTTGCTCTCC
CGTACCCTGCACGGCGTCATGCAAAATATCCGTGACATCGTCAACCTCAAAAAGTCGACCTTTTGGAACAAGGGC
GGACCCGCGTGGCAAAAGATTGTCGTCTGTCTCGTCTTCGACGGCATCGAAAAGGCCGACAAGAACACGCTCGAC
GTGCTCGCCACCGTTGGCGTCTACCAGGACGGCGTCATCAAAAAGGATGTCGACGGCAAGGAGACGGTCGCCCAC
ATCTTCGAGTACACCAGCCAGCTGTCCGTGACGCCCAACCAGCAGCTCATCCGCCCCAAGGACGATAGCCCGCAA
AACCTGCCGCCCGTGCAGTTCATCTTCTGCCTCAAGCAGAAGAACAGCAAGAAGATCAACTCGCACCGCTGGCTC
TTCAATGCCTTTGGCCGCATCCTCAACCCAGAGGTCACCATCCTCATCGATGCCGGCACCAAGCCCGGCCCCCGC
TCGCTGCTGGCCCTATGGGAGGGCTTCTACAACGACAAGGACCTCGGCGGCGCCTGCGGCGAGATTCACGCCATG
CTGGGCAAGGGCGGCAAGAAGCTGCTCAATCCGCTGGTGGCAGTGCAGAACTTTGAGTACAAAATCTCAAACATC
CTCGACAAGCCGCTCGAGAGCTCGTTTGGCTACGTCAGCGTTCTGCCCGGTGCCTTCTCGGCGTACCGCTTCCGC
GCAATCATGGGTCGGCCGTTGGAGCAGTACTTCCACGGCGACCACACGCTGTCCAAGATCCTGGGCAAGAAGGGC
ATCGACGGCATGAACATCTTCAAAAAGAACATGTTCCTCGCCGAGGACCGCATCCTGTGCTTCGAGCTCGTCGCA
AAGGCCGGCCAGAAGTGGCACCTGACGTACATCAAGGCGGCCAAGGGCGAGACGGATGTGCCCGAGGGCGCGCCC
GAGTTCATCAGCCAGCGTCGGCGCTGGCTCAACGGCTCTTTTGCCGCCTCGCTCTATTCGCTCATGCACTTTGGT
CGTATCTACAAGAGTGGCCACAACATCATCCGCATGTTCTTCTTCCACATTCAGCTCATCTACAACTTCCTCAAC
CTCGTCTTCTCATGGTTCTCGCTGGCGTCGTACTACCTGACGACGACGGTCATCATGGACCTGGTCGGCACCCCC
GTCGTCGCCTCTGACTCGGCCTCTGAGCACCACGGTTGGCCCTTTGGCGACACGGCGACGCCCATCGTCAACGCG
CTGCTCAAGTACCTTTACCTGGCCTTTGTCATCCTGCAGTTCATCCTGGCGCTCGGCAACCGACCCAAGGGCTCC
AAGTTTACGTACATTGCGTCTTTCATGCTCTTCGGCCTCATCCAGGGCTACATTCTGGTGCTGTCGGGCTACTTG
GTGGCGCGGGCCTTTAACACTCCCCTGGCCAAGCAAATCTCTCTCGCGTCGGGCGGCGACTTCGTCCGCAGTTTC
TTCATCGGATCCGGGGCAGCGGGCGTGATCTTGATTGCACTCATCACGATCTACGGGCTCTACTTTATCGCGTCC
TTCTTGTACCTGGACCCCTGGCACATGTTCCACTCGTTCCCGTCCTACATGATCCTCATGTCGACGTACATCAAC
ATCCTGATGGTCTATGCCTTCAACAACTGGCACGACGTCTCGTGGGGTACGAAAGGCTCCGACGCATCGGACGCG
CTGCCGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGCGGTGGTTGAGGAAATTGAGAAGGAGCAGGAGGAC
ATCGACAGCCAGTTTGAGCAGACGGTGCGTCGTGCTCTGGCGCCCTTTAAGGAGGCGGACGAGGATGAGAAGAAG
GACGTCGAGGATGGGTACAAGTCTTTCCGGACGGGCCTGGTCGTCTCCTGGCTCTTCTCCAACATTTTGCTCGTC
ATCGTTATTACCAGCGACAACTTTAATTCGTTTGGCATCGGAGTGAGTCTTGCGTCCGTCCCCGGCTATAACAAG
AGATCGACTAAAGAGTGGTGTACAGAAATCGGCATCGGTCCGCACGGCCAACTTTTTCAAGTTTCTGCTGTACGC
CACGGCGGTGCTGTCGCTGATCCGCTTCTTCGGCTTCCTTTGGTACCTGGGTAGGACGGGCATCATGTGCTGCTT
TGCGCGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail