Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02057
Gene name
Locationscaffold_02:2493293..2494071
Strand+
Gene length (bp)778
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 7.9E-50 9 186
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.3E-16 9 110

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.3934 0.2869 0.029 0.6458 0.1753 0.0133 0.1858 0.409 0.4331 0.1145

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup658
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4847
Ophiocordyceps australis map64 (Brazil) OphauB2|5305
Ophiocordyceps camponoti-floridani Ophcf2|02057 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07433
Ophiocordyceps camponoti-rufipedis Ophun1|1028
Ophiocordyceps kimflemingae Ophio5|7404
Ophiocordyceps subramaniannii Hirsu2|10659

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02057
MAGRMVLYKLVVLGDGGVGKTALTIQLCLQHFVETYDPTIEDSYRKQVVIDNQPCMLEVLDTAGQEEYTALRDQW
IRDGEGFVLVYSISSRSSFARIRRFHHQIQRVKESCASSPSYPGSPLSAAAQQMPVPVMLVGNKSDRITEREVST
QEGHAMARELGCEFTEASAKNCIHVEKAFYDVVRILRRQRQQVAHPPAGSSGRSRTSGNGDVGGGRDREFSRYRR
SKDGEKTKSRCVVL*
Coding >Ophcf2|02057
ATGGCCGGTCGCATGGTCTTGTACAAGCTCGTCGTCCTCGGCGATGGCGGCGTCGGCAAGACGGCTCTCACAATC
CAGCTGTGTCTGCAGCATTTCGTCGAGACGTACGACCCGACAATCGAAGACTCGTACCGCAAGCAGGTCGTCATC
GATAACCAGCCGTGCATGCTCGAGGTCCTCGATACCGCCGGCCAAGAAGAATACACGGCCCTGCGCGATCAATGG
ATCCGCGACGGAGAGGGCTTCGTTCTAGTCTACAGCATATCTTCACGCTCCTCCTTTGCCCGCATTCGCCGCTTT
CACCACCAGATTCAGCGCGTCAAGGAGTCGTGCGCCTCATCACCCTCGTATCCCGGTTCGCCCCTGTCGGCAGCC
GCTCAGCAAATGCCCGTACCCGTCATGCTCGTCGGCAACAAGAGCGACCGCATCACCGAACGAGAGGTTTCCACC
CAGGAAGGCCACGCCATGGCCCGCGAGCTGGGCTGCGAGTTCACAGAGGCCTCGGCCAAGAACTGCATCCACGTC
GAAAAGGCCTTTTACGACGTTGTCCGCATCCTGAGGCGCCAGCGTCAGCAGGTCGCCCATCCCCCCGCCGGCTCC
AGCGGCCGCTCCAGGACGTCTGGCAACGGCGACGTCGGCGGCGGTCGAGACCGTGAATTTTCCCGCTACCGGCGC
AGCAAAGACGGGGAGAAGACAAAGTCGAGATGCGTCGTGTTATGA
Transcript >Ophcf2|02057
ATGGCCGGTCGCATGGTCTTGTACAAGCTCGTCGTCCTCGGCGATGGCGGCGTCGGCAAGACGGCTCTCACAATC
CAGCTGTGTCTGCAGCATTTCGTCGAGACGTACGACCCGACAATCGAAGACTCGTACCGCAAGCAGGTCGTCATC
GATAACCAGCCGTGCATGCTCGAGGTCCTCGATACCGCCGGCCAAGAAGAATACACGGCCCTGCGCGATCAATGG
ATCCGCGACGGAGAGGGCTTCGTTCTAGTCTACAGCATATCTTCACGCTCCTCCTTTGCCCGCATTCGCCGCTTT
CACCACCAGATTCAGCGCGTCAAGGAGTCGTGCGCCTCATCACCCTCGTATCCCGGTTCGCCCCTGTCGGCAGCC
GCTCAGCAAATGCCCGTACCCGTCATGCTCGTCGGCAACAAGAGCGACCGCATCACCGAACGAGAGGTTTCCACC
CAGGAAGGCCACGCCATGGCCCGCGAGCTGGGCTGCGAGTTCACAGAGGCCTCGGCCAAGAACTGCATCCACGTC
GAAAAGGCCTTTTACGACGTTGTCCGCATCCTGAGGCGCCAGCGTCAGCAGGTCGCCCATCCCCCCGCCGGCTCC
AGCGGCCGCTCCAGGACGTCTGGCAACGGCGACGTCGGCGGCGGTCGAGACCGTGAATTTTCCCGCTACCGGCGC
AGCAAAGACGGGGAGAAGACAAAGTCGAGATGCGTCGTGTTATGA
Gene >Ophcf2|02057
ATGGCCGGTCGCATGGTCTTGTACAAGCTCGTCGTCCTCGGCGATGGCGGCGTCGGCAAGACGGCTCTCACAATC
CAGCTGTGTCTGCAGCATTTCGTCGAGACGGTAAGTCTGGTATCCTCTCCTTCTCCTTTGTCCTGCATCCTGACG
CCGACCCATCCAGTACGACCCGACAATCGAAGACTCGTACCGCAAGCAGGTCGTCATCGATAACCAGCCGTGCAT
GCTCGAGGTCCTCGATACCGCCGGCCAAGAAGAATACACGGCCCTGCGCGATCAATGGATCCGCGACGGAGAGGG
CTTCGTTCTAGTCTACAGCATATCTTCACGCTCCTCCTTTGCCCGCATTCGCCGCTTTCACCACCAGATTCAGCG
CGTCAAGGAGTCGTGCGCCTCATCACCCTCGTATCCCGGTTCGCCCCTGTCGGCAGCCGCTCAGCAAATGCCCGT
ACCCGTCATGCTCGTCGGCAACAAGAGCGACCGCATCACCGAACGAGAGGTTTCCACCCAGGAAGGCCACGCCAT
GGCCCGCGAGCTGGGCTGCGAGTTCACAGAGGCCTCGGCCAAGAACTGCATCCACGTCGAAAAGGCCTTTTACGA
CGTTGTCCGCATCCTGAGGCGCCAGCGTCAGCAGGTCGCCCATCCCCCCGCCGGCTCCAGCGGCCGCTCCAGGAC
GTCTGGCAACGGCGACGTCGGCGGCGGTCGAGACCGTGAATTTTCCCGCTACCGGCGCAGCAAAGACGGGGAGAA
GACAAAGTCGAGATGCGTCGTGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail