Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02053
Gene name
Locationscaffold_02:2481696..2482617
Strand-
Gene length (bp)921
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02338 OTU OTU-like cysteine protease 7.3E-20 171 296

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.8203 0.6579 0.0246 0.0461 0.0706 0.0025 0.2843 0.1843 0.2347 0.0351

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6143
Ophiocordyceps australis map64 (Brazil) OphauB2|5310
Ophiocordyceps camponoti-floridani Ophcf2|02053 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07437
Ophiocordyceps camponoti-rufipedis Ophun1|7015
Ophiocordyceps kimflemingae Ophio5|7398
Ophiocordyceps subramaniannii Hirsu2|792

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02053
MTSSNDTESAEQMQARHRRELKDLQGRITNKKKNASKKTRKGVNAECEELERQLREKHAVELAVVNGEISQEVDD
DDHDDDDDDDDDEQQPQTTTEAKITPFEIPTQTQQPPQKKRNRQRDRLARRAAEKNAQAQRAGDEAASMTDHRAV
ESEAMKKAMEVHGLVEHQVAPDGHCLFSAVADQLAQRSVPLGDHDAPSEPAYRRVRRAAAAYMVENADEFAPFLS
EDLDGYAARMRDTAEWGGQLELTALARRYGAEIRVLQPGRIETIGQDEGRTTGRTLWLAYYRHGYGLGEHYNSLR
DKTETR*
Coding >Ophcf2|02053
ATGACGTCGTCCAACGACACCGAATCGGCCGAGCAGATGCAGGCGCGCCACCGCAGAGAACTCAAAGACCTACAA
GGCCGCATCACCAACAAGAAGAAGAACGCAAGTAAGAAGACGCGCAAAGGCGTCAACGCCGAATGCGAAGAGCTC
GAACGCCAGCTGCGGGAGAAGCACGCCGTCGAGCTGGCAGTCGTCAATGGCGAGATCTCCCAAGAAGTCGATGAC
GACGACCATGATGATGACGACGACGACGACGACGACGAGCAACAGCCACAGACGACAACCGAAGCCAAAATTACC
CCCTTTGAAATTCCCACTCAGACGCAACAGCCTCCGCAAAAGAAACGCAACAGGCAACGCGACCGCCTCGCCCGA
AGAGCGGCAGAGAAAAACGCCCAGGCCCAACGCGCAGGCGACGAAGCGGCCTCCATGACCGACCACCGCGCCGTC
GAAAGCGAAGCCATGAAGAAGGCCATGGAAGTTCACGGACTGGTAGAGCACCAGGTCGCTCCCGATGGCCATTGT
CTCTTCTCCGCCGTCGCCGATCAGCTCGCCCAAAGATCCGTCCCCTTGGGCGACCATGACGCCCCATCTGAGCCG
GCCTATCGACGGGTCCGGCGCGCGGCGGCCGCCTACATGGTGGAAAATGCGGATGAGTTTGCGCCTTTCCTTTCC
GAGGACCTGGACGGATATGCGGCTAGGATGCGCGACACTGCTGAGTGGGGTGGCCAGCTGGAGCTCACGGCGCTG
GCGAGGCGGTACGGCGCCGAGATTCGCGTCTTGCAGCCGGGCCGTATCGAGACCATCGGTCAAGACGAGGGTCGG
ACGACGGGGCGGACGCTGTGGCTGGCTTACTATCGACACGGATACGGGCTGGGGGAGCACTACAACTCGCTGCGG
GACAAGACGGAGACAAGGTGA
Transcript >Ophcf2|02053
ATGACGTCGTCCAACGACACCGAATCGGCCGAGCAGATGCAGGCGCGCCACCGCAGAGAACTCAAAGACCTACAA
GGCCGCATCACCAACAAGAAGAAGAACGCAAGTAAGAAGACGCGCAAAGGCGTCAACGCCGAATGCGAAGAGCTC
GAACGCCAGCTGCGGGAGAAGCACGCCGTCGAGCTGGCAGTCGTCAATGGCGAGATCTCCCAAGAAGTCGATGAC
GACGACCATGATGATGACGACGACGACGACGACGACGAGCAACAGCCACAGACGACAACCGAAGCCAAAATTACC
CCCTTTGAAATTCCCACTCAGACGCAACAGCCTCCGCAAAAGAAACGCAACAGGCAACGCGACCGCCTCGCCCGA
AGAGCGGCAGAGAAAAACGCCCAGGCCCAACGCGCAGGCGACGAAGCGGCCTCCATGACCGACCACCGCGCCGTC
GAAAGCGAAGCCATGAAGAAGGCCATGGAAGTTCACGGACTGGTAGAGCACCAGGTCGCTCCCGATGGCCATTGT
CTCTTCTCCGCCGTCGCCGATCAGCTCGCCCAAAGATCCGTCCCCTTGGGCGACCATGACGCCCCATCTGAGCCG
GCCTATCGACGGGTCCGGCGCGCGGCGGCCGCCTACATGGTGGAAAATGCGGATGAGTTTGCGCCTTTCCTTTCC
GAGGACCTGGACGGATATGCGGCTAGGATGCGCGACACTGCTGAGTGGGGTGGCCAGCTGGAGCTCACGGCGCTG
GCGAGGCGGTACGGCGCCGAGATTCGCGTCTTGCAGCCGGGCCGTATCGAGACCATCGGTCAAGACGAGGGTCGG
ACGACGGGGCGGACGCTGTGGCTGGCTTACTATCGACACGGATACGGGCTGGGGGAGCACTACAACTCGCTGCGG
GACAAGACGGAGACAAGGTGA
Gene >Ophcf2|02053
ATGACGTCGTCCAACGACACCGAATCGGCCGAGCAGATGCAGGCGCGCCACCGCAGAGAACTCAAAGACCTACAA
GGCCGCATCACCAACAAGAAGAAGAACGCAAGTAAGAAGACGCGCAAAGGCGTCAACGCCGAATGCGAAGAGCTC
GAACGCCAGCTGCGGGAGAAGCACGCCGTCGAGCTGGCAGTCGTCAATGGCGAGATCTCCCAAGAAGTCGATGAC
GACGACCATGATGATGACGACGACGACGACGACGACGAGCAACAGCCACAGACGACAACCGAAGCCAAAATTACC
CCCTTTGAAATTCCCACTCAGACGCAACAGCCTCCGCAAAAGAAACGCAACAGGCAACGCGACCGCCTCGCCCGA
AGAGCGGCAGAGAAAAACGCCCAGGCCCAACGCGCAGGCGACGAAGCGGCCTCCATGACCGACCACCGCGCCGTC
GAAAGCGAAGCCATGAAGAAGGCCATGGAAGTTCACGGACTGGTAGAGCACCAGGTCGCTCCCGATGGCCATTGT
CTCTTCTCCGCCGTCGCCGATCAGCTCGCCCAAAGATCCGTCCCCTTGGGCGACCATGACGCCCCATCTGAGCCG
GCCTATCGACGGGTCCGGCGCGCGGCGGCCGCCTACATGGTGGAAAATGCGGATGAGTTTGCGCCTTTCCTTTCC
GAGGACCTGGACGGATATGCGGCTAGGATGCGCGACACTGCTGAGTGGGGTGGCCAGCTGGAGCTCACGGCGCTG
GCGAGGCGGTACGGCGCCGAGATTCGCGTCTTGCAGCCGGGCCGTATCGAGACCATCGGTCAAGACGAGGGTCGG
ACGACGGGGCGGACGCTGTGGCTGGCTTACTATCGACACGGATACGGGCTGGGGGAGCACTACAACTCGCTGCGG
GACAAGACGGAGACAAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail