Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02052
Gene name
Locationscaffold_02:2480788..2481587
Strand+
Gene length (bp)799
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05724 TPMT Thiopurine S-methyltransferase (TPMT) 3.8E-22 42 188

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8524 0.6389 0.0493 0.0139 0.1933 0.014 0.0801 0.0969 0.3738 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup980
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6142
Ophiocordyceps australis map64 (Brazil) OphauB2|5311
Ophiocordyceps camponoti-floridani Ophcf2|02052 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07438
Ophiocordyceps camponoti-rufipedis Ophun1|7014
Ophiocordyceps kimflemingae Ophio5|7397
Ophiocordyceps subramaniannii Hirsu2|791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02052
MSTTAATNPPTNPPRTGRGPSLALADLLSQRPDLVPPAPAPSPRRATALVPGCGLGHDALLLASYGYDVWALDER
DGAWEEDEEEDEVACLYPAVREHVGCGAVTWLVADFLADEWSHGLGFDLIFDYTFLCALAPQHRPRWAKRITQLM
LPGGRLVCLEYPSWKPMSEPGPPWGVSPELYEALLSAPGEAPAYGADGSVVADPIAQPRHDALHRLAIIKPTRTH
DAGTGPDGSVLDFISVWSR*
Coding >Ophcf2|02052
ATGTCAACGACAGCAGCAACAAACCCCCCAACAAACCCCCCCCGAACAGGTCGGGGCCCCTCTCTGGCCCTAGCA
GACCTCCTCTCCCAGAGACCAGACCTGGTTCCCCCCGCGCCGGCCCCTTCGCCGCGACGCGCAACCGCCCTCGTC
CCGGGCTGTGGCCTCGGGCACGATGCGCTGCTGCTCGCCTCGTACGGGTACGATGTTTGGGCGCTGGATGAGAGG
GATGGGGCGTGGGAGGAGGACGAGGAGGAGGACGAGGTTGCATGCTTGTATCCGGCTGTGCGGGAACATGTTGGA
TGCGGCGCCGTTACTTGGCTTGTCGCCGACTTCCTGGCTGACGAGTGGTCGCACGGCCTAGGCTTTGACCTCATC
TTTGACTATACGTTCTTATGCGCCCTCGCGCCACAACATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATG
TTGCCCGGTGGTCGCCTCGTCTGTCTCGAGTACCCTTCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGC
GTCAGTCCGGAGCTGTACGAGGCCCTTCTGTCGGCACCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTC
GTCGCCGACCCCATCGCCCAGCCCCGTCACGACGCCCTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCAC
GACGCCGGAACCGGGCCTGATGGCTCCGTCCTCGACTTCATCTCTGTCTGGTCCCGGTGA
Transcript >Ophcf2|02052
ATGTCAACGACAGCAGCAACAAACCCCCCAACAAACCCCCCCCGAACAGGTCGGGGCCCCTCTCTGGCCCTAGCA
GACCTCCTCTCCCAGAGACCAGACCTGGTTCCCCCCGCGCCGGCCCCTTCGCCGCGACGCGCAACCGCCCTCGTC
CCGGGCTGTGGCCTCGGGCACGATGCGCTGCTGCTCGCCTCGTACGGGTACGATGTTTGGGCGCTGGATGAGAGG
GATGGGGCGTGGGAGGAGGACGAGGAGGAGGACGAGGTTGCATGCTTGTATCCGGCTGTGCGGGAACATGTTGGA
TGCGGCGCCGTTACTTGGCTTGTCGCCGACTTCCTGGCTGACGAGTGGTCGCACGGCCTAGGCTTTGACCTCATC
TTTGACTATACGTTCTTATGCGCCCTCGCGCCACAACATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATG
TTGCCCGGTGGTCGCCTCGTCTGTCTCGAGTACCCTTCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGC
GTCAGTCCGGAGCTGTACGAGGCCCTTCTGTCGGCACCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTC
GTCGCCGACCCCATCGCCCAGCCCCGTCACGACGCCCTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCAC
GACGCCGGAACCGGGCCTGATGGCTCCGTCCTCGACTTCATCTCTGTCTGGTCCCGGTGA
Gene >Ophcf2|02052
ATGTCAACGACAGCAGCAACAAACCCCCCAACAAACCCCCCCCGAACAGGTCGGGGCCCCTCTCTGGCCCTAGCA
GACCTCCTCTCCCAGAGACCAGACCTGGTTCCCCCCGCGCCGGCCCCTTCGCCGCGACGCGCAACCGCCCTCGTC
CCGGGCTGTGGCCTCGGGCACGATGCGCTGCTGCTCGCCTCGTACGGGTACGATGTTTGGGCGCTGGATGAGAGG
GATGGGGCGTGGGAGGAGGACGAGGAGGAGGACGAGGTTGCATGCTTGTATCCGGCTGTGCGGGAACATGTTGGA
TGCGGCGCCGTTACTTGGCTTGTCGCCGACTTCCTGGCTGACGAGTGGTCGCACGGCCTAGGCTTTGACCTCATC
TTTGACTATACGGTTGCTTCCCCCTTTCCGGCATTTTGCTTGATATCCCTTTTCATCTGACGAGACGGATCGGTA
GTTCTTATGCGCCCTCGCGCCACAACATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATGTTGCCCGGTGG
TCGCCTCGTCTGTCTCGAGTACCCTTCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGCGTCAGTCCGGA
GCTGTACGAGGCCCTTCTGTCGGCACCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTCGTCGCCGACCC
CATCGCCCAGCCCCGTCACGACGCCCTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCACGACGCCGGAAC
CGGGCCTGATGGCTCCGTCCTCGACTTCATCTCTGTCTGGTCCCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail