Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02048
Gene name
Locationscaffold_02:2472430..2475866
Strand+
Gene length (bp)3436
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10607 CTLH CTLH/CRA C-terminal to LisH motif domain 7.3E-30 464 653
PF00622 SPRY SPRY domain 4.5E-27 256 374

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6256 0.6272 0.11 0.0539 0.1105 0.0189 0.1744 0.2687 0.1939 0.14

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup608
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|334
Ophiocordyceps australis map64 (Brazil) OphauB2|5315
Ophiocordyceps camponoti-floridani Ophcf2|02048 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5676
Ophiocordyceps kimflemingae Ophio5|782
Ophiocordyceps kimflemingae Ophio5|918
Ophiocordyceps subramaniannii Hirsu2|9063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02048
MSACPVWHRPAVEPRQHRLALCLPLSSCLHLALVLPGSDPTGEGSQGRRLPSATPPFYAHPARVSALSADGRLLV
DPPPGFPGVMDASANDDMLHVWSVSGSLPSFSRAFDMFTQPLDSDGGQFFVPSHLRGTTYIKMLHEAHKAKLQAQ
RESRRPSGVAMTSNATAFVQPPRAPSAHRGLAQNVVEQPAADEDDADAPVPPLPSRWNKDDLWPGIDLQPDDLSV
KYTGQKNNHERDHEASAVRSDHYMPPQCGLYYYEVQILHGKRDDTTIAVGFSTKATSLSRPVGWEPDSWGYHGDD
GRCFFGQNSGRSYGPTFNAGDVVGCGVNFRDNTAFFTKNGVKLDVAFQDVAKGKLYPSVSLKKPGEHILANFGQV
PFVYNIDNLMRDERKKMQQEILETDTSKLEPGMNETDLIQTLVLQFLQHDGHVETARAFAEDMRAQKRALSLDPN
TDVAGINIKDEEDANNRQRIRKAILEGDIDRALKYTNAYYPQVLQDNEEVYFRLRCRKFIEMVCKAAHMRAASDG
RRSNGHGATAGDMDVDVNGADDSMDMDGSEQTELMKLEQDMLEFGQALEAQYANDQRKDVSQTLGEIWALVAYSN
PLKEPMVSHLLDRKGRATVAEELNSAILTSLGKSPRASLERVFAQTSVLLEELRRKGGPGAFVSLQELLDEIGES
TRV*
Coding >Ophcf2|02048
ATGTCAGCCTGCCCCGTCTGGCATCGGCCCGCCGTCGAACCTCGCCAGCATCGGCTCGCCCTTTGTCTGCCGCTC
TCCAGCTGCTTGCATCTCGCCCTCGTTTTGCCAGGCTCAGACCCGACTGGCGAAGGCTCCCAAGGCCGACGGCTT
CCGTCTGCCACGCCTCCCTTCTACGCACACCCTGCTCGAGTCTCGGCCTTGAGTGCCGACGGCCGCCTGCTCGTC
GATCCCCCACCCGGCTTCCCCGGCGTCATGGATGCGTCAGCAAACGACGATATGCTGCACGTTTGGAGTGTCAGC
GGTAGCTTGCCGTCCTTCTCGCGAGCCTTCGATATGTTCACCCAACCTCTCGACTCCGACGGAGGCCAGTTCTTC
GTGCCCTCGCATCTGCGCGGCACCACGTACATCAAGATGCTCCACGAGGCGCACAAGGCCAAGTTGCAGGCCCAG
AGGGAGTCGAGGCGGCCCTCGGGCGTGGCCATGACCAGCAACGCCACCGCCTTTGTACAGCCGCCGCGGGCGCCG
AGCGCTCATCGTGGCCTGGCCCAGAACGTGGTCGAGCAACCGGCCGCGGACGAAGACGACGCGGACGCTCCCGTA
CCGCCTCTACCGTCGCGATGGAACAAGGACGACCTGTGGCCCGGCATCGATCTCCAACCCGATGATCTCAGCGTA
AAGTACACCGGGCAAAAGAATAATCACGAGCGCGATCACGAGGCATCAGCGGTCCGCTCCGACCACTACATGCCT
CCTCAGTGCGGGCTGTACTATTACGAGGTTCAAATTCTACATGGAAAGCGTGACGATACCACCATCGCAGTCGGA
TTCTCGACCAAGGCGACGTCTCTCTCGAGACCAGTCGGCTGGGAGCCCGACTCATGGGGTTATCACGGCGACGAC
GGACGTTGCTTCTTCGGACAGAATTCGGGTCGAAGTTACGGGCCAACCTTCAACGCCGGTGACGTCGTCGGCTGC
GGCGTGAATTTTCGAGACAACACGGCCTTCTTCACCAAAAACGGCGTCAAGCTTGACGTAGCCTTTCAAGACGTC
GCCAAGGGCAAGCTGTACCCATCCGTCAGCCTCAAGAAGCCCGGCGAACACATCCTTGCCAACTTTGGTCAGGTC
CCTTTCGTCTACAACATCGACAATCTGATGCGAGACGAGCGGAAGAAAATGCAACAAGAAATCTTGGAGACGGAC
ACTTCCAAGCTGGAGCCCGGCATGAACGAGACAGACCTCATTCAGACGCTGGTACTTCAGTTTCTGCAACACGAC
GGGCACGTTGAGACGGCGCGAGCCTTTGCTGAGGACATGCGAGCGCAAAAGAGGGCGCTGAGCCTGGATCCCAAC
ACCGACGTGGCCGGCATCAACATTAAGGATGAGGAGGATGCCAACAATCGGCAGCGGATTCGGAAAGCCATATTG
GAGGGAGACATCGACCGTGCCCTCAAGTACACCAACGCATACTATCCGCAGGTGCTCCAGGACAACGAAGAGGTC
TACTTTCGGTTGCGCTGTCGCAAGTTTATCGAGATGGTCTGTAAGGCGGCCCATATGCGAGCGGCAAGCGACGGC
AGGAGAAGCAACGGTCACGGGGCGACAGCCGGAGACATGGACGTCGACGTCAACGGAGCCGACGACAGCATGGAC
ATGGACGGTTCGGAGCAGACGGAGCTCATGAAGCTGGAGCAGGACATGCTCGAGTTCGGACAGGCTCTCGAGGCG
CAGTACGCCAACGATCAGCGCAAGGACGTCAGCCAGACGCTGGGCGAGATTTGGGCGCTGGTCGCCTACTCGAAT
CCGCTCAAGGAGCCCATGGTCAGTCACCTGCTGGACCGCAAGGGACGAGCGACGGTCGCCGAAGAGCTCAACTCT
GCCATCCTGACCTCGCTGGGCAAGTCTCCGCGCGCCTCGCTGGAGAGGGTCTTCGCGCAGACGAGCGTGTTGCTG
GAGGAGCTCCGGCGCAAAGGCGGACCCGGGGCCTTTGTCTCGCTGCAGGAGCTGCTGGACGAGATTGGCGAGTCA
ACACGGGTGTGA
Transcript >Ophcf2|02048
ATGTCAGCCTGCCCCGTCTGGCATCGGCCCGCCGTCGAACCTCGCCAGCATCGGCTCGCCCTTTGTCTGCCGCTC
TCCAGCTGCTTGCATCTCGCCCTCGTTTTGCCAGGCTCAGACCCGACTGGCGAAGGCTCCCAAGGCCGACGGCTT
CCGTCTGCCACGCCTCCCTTCTACGCACACCCTGCTCGAGTCTCGGCCTTGAGTGCCGACGGCCGCCTGCTCGTC
GATCCCCCACCCGGCTTCCCCGGCGTCATGGATGCGTCAGCAAACGACGATATGCTGCACGTTTGGAGTGTCAGC
GGTAGCTTGCCGTCCTTCTCGCGAGCCTTCGATATGTTCACCCAACCTCTCGACTCCGACGGAGGCCAGTTCTTC
GTGCCCTCGCATCTGCGCGGCACCACGTACATCAAGATGCTCCACGAGGCGCACAAGGCCAAGTTGCAGGCCCAG
AGGGAGTCGAGGCGGCCCTCGGGCGTGGCCATGACCAGCAACGCCACCGCCTTTGTACAGCCGCCGCGGGCGCCG
AGCGCTCATCGTGGCCTGGCCCAGAACGTGGTCGAGCAACCGGCCGCGGACGAAGACGACGCGGACGCTCCCGTA
CCGCCTCTACCGTCGCGATGGAACAAGGACGACCTGTGGCCCGGCATCGATCTCCAACCCGATGATCTCAGCGTA
AAGTACACCGGGCAAAAGAATAATCACGAGCGCGATCACGAGGCATCAGCGGTCCGCTCCGACCACTACATGCCT
CCTCAGTGCGGGCTGTACTATTACGAGGTTCAAATTCTACATGGAAAGCGTGACGATACCACCATCGCAGTCGGA
TTCTCGACCAAGGCGACGTCTCTCTCGAGACCAGTCGGCTGGGAGCCCGACTCATGGGGTTATCACGGCGACGAC
GGACGTTGCTTCTTCGGACAGAATTCGGGTCGAAGTTACGGGCCAACCTTCAACGCCGGTGACGTCGTCGGCTGC
GGCGTGAATTTTCGAGACAACACGGCCTTCTTCACCAAAAACGGCGTCAAGCTTGACGTAGCCTTTCAAGACGTC
GCCAAGGGCAAGCTGTACCCATCCGTCAGCCTCAAGAAGCCCGGCGAACACATCCTTGCCAACTTTGGTCAGGTC
CCTTTCGTCTACAACATCGACAATCTGATGCGAGACGAGCGGAAGAAAATGCAACAAGAAATCTTGGAGACGGAC
ACTTCCAAGCTGGAGCCCGGCATGAACGAGACAGACCTCATTCAGACGCTGGTACTTCAGTTTCTGCAACACGAC
GGGCACGTTGAGACGGCGCGAGCCTTTGCTGAGGACATGCGAGCGCAAAAGAGGGCGCTGAGCCTGGATCCCAAC
ACCGACGTGGCCGGCATCAACATTAAGGATGAGGAGGATGCCAACAATCGGCAGCGGATTCGGAAAGCCATATTG
GAGGGAGACATCGACCGTGCCCTCAAGTACACCAACGCATACTATCCGCAGGTGCTCCAGGACAACGAAGAGGTC
TACTTTCGGTTGCGCTGTCGCAAGTTTATCGAGATGGTCTGTAAGGCGGCCCATATGCGAGCGGCAAGCGACGGC
AGGAGAAGCAACGGTCACGGGGCGACAGCCGGAGACATGGACGTCGACGTCAACGGAGCCGACGACAGCATGGAC
ATGGACGGTTCGGAGCAGACGGAGCTCATGAAGCTGGAGCAGGACATGCTCGAGTTCGGACAGGCTCTCGAGGCG
CAGTACGCCAACGATCAGCGCAAGGACGTCAGCCAGACGCTGGGCGAGATTTGGGCGCTGGTCGCCTACTCGAAT
CCGCTCAAGGAGCCCATGGTCAGTCACCTGCTGGACCGCAAGGGACGAGCGACGGTCGCCGAAGAGCTCAACTCT
GCCATCCTGACCTCGCTGGGCAAGTCTCCGCGCGCCTCGCTGGAGAGGGTCTTCGCGCAGACGAGCGTGTTGCTG
GAGGAGCTCCGGCGCAAAGGCGGACCCGGGGCCTTTGTCTCGCTGCAGGAGCTGCTGGACGAGATTGGCGAGTCA
ACACGGGTGTGA
Gene >Ophcf2|02048
ATGTCAGTAAAGGGTGGGACGGGGTCACGTGTGCGGCTGGCAGAAGGGAGACGTCGTGCGTTGGGGGAGGGGAAC
GTGTGATGTAGTTTCCTGATAGGGAGAAGAGTTCCGCTATAATGGCGGCTAGAGGCCAAGGCAGATGCTGCTTTC
GATGGGCGATGATTGACGATTAGACACTCTCTTGTTGAGTACATACATACATACGACTACGAATGCACGGATATT
CATCTCTAAATATGCATACCTACCAGGTACCTACCTGCCTATCTACTTTGTACGAATACCAGGCACGTCGCCCGC
CCTTGCTGCTTCTGCCCGCTCTGGCTACCTACCACCAGGCTACCAAAAAGCACGGCCTGCCAGCCTGTCTCTCGT
AGCCCGCATCCCCCATCGCAAAAGTACCACAGCTCGCCGAGATACACGTCGCCCCCTCCGGGTCCCCCGCACCCT
CAGGCGTACCCCTCCTCTGCTCAGGTACATAGATACACTGTACCATCACACCCAGCAGTAGGGGCCCAACAGGGG
CAGCCCGCGACTTTCATCAGCGTCCAAAGGGCCAGCCCCTGCTGAAACCGGCGCCGGCGGCTCACCGATTCCTCC
TCCAGGTCTCTTCCGTGACGTCGACAACGATCAACGACTGCACCTCAATTTCTCGTCCCATCCTACGGCCTCGAC
TGCCCTCTCTGTCTTTGTCTCTCTCCGTGTGGCTCGGGCCCGTCACTATTACATCCCGCTCCGCCACTCGGCCGT
CGTCGAGGCGGCGGGGAGAGGGAAAGGGCAAATCCAGTCCGCCTTCCGAACCGTCAACTCTTCTCGACGACACCT
CCTCCATCGCCCTTCCGTCCCTCGGCCTACATTCTCTACCTACTAGATACAGATCAGAGATACATACGATCATCT
GCTCTCGGGCTCTGAGACTCGTCTCGCCAGACCAGATCGCTAGCGGTGCCTGTCCTACAGGCCTGCCCCGTCTGG
CATCGGCCCGCCGTCGAACCTCGCCAGCATCGGCTCGCCCTTTGTCTGCCGCTGTTTCGTCTCGGAACGAGTGGC
AGAGCCGGCTGGCTGAAGCTTCCACGAAAGCTCCAGCTGCTTGCATCTCGCCCTCGTTTTGCCAGGCACGCCTCT
TCCCGTCCCGTCCCCCGCTCCTCCGTCATGCACGCTCCCTTTGGTCAGGGCTCATCTGGCCTCCCAGGCTCAGAC
CCGACTGGCGAAGGCTCCCAAGGCCGACGGCTTCCGTCTGCCACGCCTCCCTTCTACGCACACCCTGCTCGAGTC
TCGGCCTTGAGTGCCGACGGCCGCCTGCTCGTCGATCCCCCACCCGGCTTCCCCGGCGTCATGGATGCGTCAGCA
AACGACGATATGCTGCACGTTTGGAGTGTCAGCGGTAGCTTGCCGTCCTTCTCGCGAGCCTTCGATATGTTCACC
CAACCTCTCGACTCCGACGGAGGCCAGTTCTTCGTGCCCTCGCATCTGCGCGGCACCACGTACATCAAGATGCTC
CACGAGGCGCACAAGGCCAAGTTGCAGGCCCAGAGGGAGTCGAGGCGGCCCTCGGGCGTGGCCATGACCAGCAAC
GCCACCGCCTTTGTACAGCCGCCGCGGGCGCCGAGCGCTCATCGTGGCCTGGCCCAGAACGTGGTCGAGCAACCG
GCCGCGGACGAAGACGACGCGGACGCTCCCGTACCGCCTCTACCGTCGCGATGGAACAAGGACGACCTGTGGCCC
GGCATCGATCTCCAACCCGATGATCTCAGCGTAAAGTACACCGGGCAAAAGAATAATCACGAGCGCGATCACGAG
GCATCAGCGGTCCGCTCCGACCACTACATGCCTCCTCAGTGCGGGCTGTACTATTACGAGGTTCAAATTCTACAT
GGAAAGCGTGACGAGTGAGTATTGTGCCTCCTCGCCTTTGGGCCGTCTCGAAAGCTGACGCTCGTCTACGCAGTA
CCACCATCGCAGTCGGATTCTCGACCAAGGCGACGTCTCTCTCGAGACCAGTCGGCTGGGAGCCCGACTCATGGG
GTTATCACGGCGACGACGGACGTTGCTTCTTCGGACAGAATTCGGGTCGAAGTTACGGGCCAACCTTCAACGCCG
GTGACGTCGTCGGCTGCGGCGTGAATTTTCGAGACAACACGGCCTTCTTCACCAAAAACGGCGTCAAGCTTGGTG
AGTGCCGCGAAATCACGATACTGCGTGTTACCTCGGCTAACGGGAATATCCTGCAGACGTAGCCTTTCAAGACGT
CGCCAAGGGCAAGCTGTACCCATCCGTCAGCCTCAAGAAGCCCGGCGAACACATCCTTGCCAACTTTGGTCAGGT
CCCTTTCGTCTACAACATCGACAATCTGATGCGAGTGCGTTGCCCCCCTCGTGCTTTCCAAAGTACCGGCCCGTC
ACAAGAGGGAGGATAGGTTGCTGACCAAGGCGGCAGGACGAGCGGAAGAAAATGCAACAAGAAATCTTGGAGACG
GACACTTCCAAGCTGGAGCCCGGCATGAACGAGACAGACCTCATTCAGACGCTGGTACTTCAGTTTCTGCAACAC
GACGGGCACGTTGAGACGGCGCGAGCCTTTGCTGAGGACATGCGAGCGCAAAAGAGGGCGCTGAGCCTGGATCCC
AACACCGACGTGGCCGGCATCAACATTAAGGATGAGGAGGATGCCAACAATCGGCAGCGTAAGTGAAGAAATGAA
GGCCATTGGTCGAGATTCCCGAGCTCACGCTGGCGCAGGGATTCGGAAAGCCATATTGGAGGGAGACATCGACCG
TGCCCTCAAGTACACCAACGCATACTATCCGCAGGTGCTCCAGGACAACGAAGAGGTCTACTTTCGGTTGCGCTG
TCGCAAGTTTATCGAGATGGTCTGTAAGGCGGCCCATATGCGAGCGGCAAGCGACGGCAGGAGAAGCAACGGTCA
CGGGGCGACAGCCGGAGACATGGACGTCGACGTCAACGGAGCCGACGACAGCATGGACATGGACGGTTCGGAGCA
GACGGAGCTCATGAAGCTGGAGCAGGACATGCTCGAGTTCGGACAGGCTCTCGAGGCGCAGTACGCCAACGATCA
GCGCAAGGACGTCAGCCAGACGCTGGGCGAGATTTGGGCGCTGGTCGCCTACTCGAATCCGCTCAAGGAGCCCAT
GGTCAGTCACCTGCTGGACCGCAAGGGACGAGCGACGGTCGCCGAAGAGCTCAACTCTGCCATCCTGAGTGAGTG
TCCCCCCCTTTCCCTCTGCACCCCTTGACCGGATGGCTGACGATTCGCCCATGACGTAGCCTCGCTGGGCAAGTC
TCCGCGCGCCTCGCTGGAGAGGGTCTTCGCGCAGACGAGCGTGTTGCTGGAGGAGCTCCGGCGCAAAGGCGGACC
CGGGGCCTTTGTCTCGCTGCAGGAGCTGCTGGACGAGATTGGCGAGTCAACACGGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail