Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02047
Gene name
Locationscaffold_02:2470656..2471537
Strand+
Gene length (bp)881
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08193 INO80_Ies4 INO80 complex subunit Ies4 1.2E-64 4 224

GO

GO Term Description Terminal node
GO:0006338 chromatin remodeling Yes
GO:0031011 Ino80 complex Yes
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:0097346 INO80-type complex No
GO:1902494 catalytic complex No
GO:1904949 ATPase complex No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0140513 nuclear protein-containing complex No
GO:0006325 chromatin organization No
GO:0016043 cellular component organization No
GO:0070603 SWI/SNF superfamily-type complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2503 0.8844 0.1077 0.0565 0.1091 0.0257 0.029 0.0033 0.0081 0.0027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4380
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3069
Ophiocordyceps australis map64 (Brazil) OphauB2|5317
Ophiocordyceps camponoti-floridani Ophcf2|02047 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5677
Ophiocordyceps kimflemingae Ophio5|6826
Ophiocordyceps subramaniannii Hirsu2|9065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02047
MAPTGKTSDARRKSAAKASLVVTLTLSPDRLRCIISPESVKDDKSSARSKDAERSPSDSSNSISATQPTTSHAEN
ASDSNAPTPAADGTPAPSAMKPPAEGPKKKGTKRSAAVANGSEKPRLEDGTIDHSGPAGRSGGTHKLGPKANQGA
INAGLRALDRSGKPCRKWCRGGFTLKSFTGVVWEVSRWRAPTKKVLEAVTDDSNAPSADNSSSKENKENGVEANS
GSNSHSGGDVDMGSVNSINASSPAPMAVVAAS*
Coding >Ophcf2|02047
ATGGCTCCGACGGGCAAGACGTCAGACGCCCGACGCAAGTCGGCCGCCAAGGCGAGCCTCGTCGTGACCCTTACC
TTATCGCCCGACCGCCTGCGATGCATCATATCTCCCGAGTCCGTCAAGGATGACAAGTCGTCGGCACGCTCCAAG
GACGCCGAGCGCTCGCCTTCCGACTCGTCGAATTCCATCTCAGCAACCCAGCCCACCACCTCTCACGCCGAAAAT
GCCTCCGACTCGAATGCCCCCACGCCCGCTGCCGACGGCACGCCCGCTCCATCCGCCATGAAGCCGCCTGCCGAG
GGCCCCAAGAAGAAGGGCACTAAGCGATCCGCTGCGGTTGCCAACGGCTCTGAAAAGCCTCGTCTCGAGGATGGC
ACCATAGACCACTCCGGTCCGGCCGGACGGTCAGGCGGTACGCACAAGCTTGGTCCCAAGGCCAATCAGGGCGCC
ATCAATGCTGGCCTCCGCGCCCTCGATCGGTCCGGAAAGCCCTGCCGTAAGTGGTGCCGGGGCGGCTTCACGCTC
AAGAGCTTCACCGGCGTCGTCTGGGAAGTCTCTCGTTGGAGGGCGCCTACCAAGAAGGTGCTCGAAGCCGTCACC
GACGACTCCAACGCCCCTTCAGCCGATAACAGCAGCAGCAAGGAAAACAAGGAGAACGGCGTCGAGGCCAATAGC
GGCAGCAACAGCCACAGCGGCGGCGACGTCGATATGGGAAGCGTCAACAGCATCAATGCCTCATCGCCGGCGCCC
ATGGCCGTCGTAGCCGCCTCCTAG
Transcript >Ophcf2|02047
ATGGCTCCGACGGGCAAGACGTCAGACGCCCGACGCAAGTCGGCCGCCAAGGCGAGCCTCGTCGTGACCCTTACC
TTATCGCCCGACCGCCTGCGATGCATCATATCTCCCGAGTCCGTCAAGGATGACAAGTCGTCGGCACGCTCCAAG
GACGCCGAGCGCTCGCCTTCCGACTCGTCGAATTCCATCTCAGCAACCCAGCCCACCACCTCTCACGCCGAAAAT
GCCTCCGACTCGAATGCCCCCACGCCCGCTGCCGACGGCACGCCCGCTCCATCCGCCATGAAGCCGCCTGCCGAG
GGCCCCAAGAAGAAGGGCACTAAGCGATCCGCTGCGGTTGCCAACGGCTCTGAAAAGCCTCGTCTCGAGGATGGC
ACCATAGACCACTCCGGTCCGGCCGGACGGTCAGGCGGTACGCACAAGCTTGGTCCCAAGGCCAATCAGGGCGCC
ATCAATGCTGGCCTCCGCGCCCTCGATCGGTCCGGAAAGCCCTGCCGTAAGTGGTGCCGGGGCGGCTTCACGCTC
AAGAGCTTCACCGGCGTCGTCTGGGAAGTCTCTCGTTGGAGGGCGCCTACCAAGAAGGTGCTCGAAGCCGTCACC
GACGACTCCAACGCCCCTTCAGCCGATAACAGCAGCAGCAAGGAAAACAAGGAGAACGGCGTCGAGGCCAATAGC
GGCAGCAACAGCCACAGCGGCGGCGACGTCGATATGGGAAGCGTCAACAGCATCAATGCCTCATCGCCGGCGCCC
ATGGCCGTCGTAGCCGCCTCCTAG
Gene >Ophcf2|02047
ATGGCTCCGACGGGCAAGACGTCAGACGCCCGACGCAAGTCGGCCGCCAAGGCGAGCCTCGTCGTGACCCTTACC
TTATCGCCCGACCGCCTGCGATGCATCATATCTCCCGAGTCCGTCAAGGATGACAAGTCGTCGGCACGCTCCAAG
GACGCCGAGCGCTCGCCTTCCGACTCGTCGAATTCCATCTCAGCAACCCAGCCCACCACCTCTCACGCCGAAAAT
GCCTCCGACTCGAATGCCCCCACGCCCGCTGCCGACGGCACGCCCGCTCCATCCGCCATGAAGCCGCCTGCCGAG
GGCCCCAAGAAGAAGGGCACTAAGCGATCCGCTGCGGTTGCCAACGGCTCTGGTGACGGAGTCGCCAAGCCAAGG
GCGAAACCCGGTCCCAAGAAAAGCCTCGTCTGTTCGTCTCCCCCTATCTCCCTCCCCCCCCCCCGAGCGTTCACT
GCGCGTACTGACTTGGCTCTAGCGAGGATGGCACCATAGACCACTCCGGTCCGGCCGGACGGTCAGGCGGTACGC
ACAAGCTTGGTCCCAAGGCCAATCAGGGCGCCATCAATGCTGGCCTCCGCGCCCTCGATCGGTCCGGAAAGCCCT
GCCGTAAGTGGTGCCGGGGCGGCTTCACGCTCAAGAGCTTCACCGGCGTCGTCTGGGAAGTCTCTCGTTGGAGGG
CGCCTACCAAGAAGGTGCTCGAAGCCGTCACCGACGACTCCAACGCCCCTTCAGCCGATAACAGCAGCAGCAAGG
AAAACAAGGAGAACGGCGTCGAGGCCAATAGCGGCAGCAACAGCCACAGCGGCGGCGACGTCGATATGGGAAGCG
TCAACAGCATCAATGCCTCATCGCCGGCGCCCATGGCCGTCGTAGCCGCCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail