Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02031
Gene name
Locationscaffold_02:2414647..2420807
Strand-
Gene length (bp)6160
Transcript length (bp)5799
Coding sequence length (bp)5799
Protein length (aa) 1933

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5719 0.3392 0.1743 0.4492 0.1291 0.0659 0.1342 0.1023 0.1288 0.0239

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4984
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02031 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5502
Ophiocordyceps kimflemingae Ophio5|6778
Ophiocordyceps subramaniannii Hirsu2|2218
Ophiocordyceps subramaniannii Hirsu2|8292

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02031
MPPPDEDEPAGQDPATASSEGKAGDGAENGQEAAADNAEAAEANQQDGKAEASNETPAASNEEPPESTDEPAQAA
DEPSAAEKPSDSPLTEDPASTSQEPEASNAGDDKKEVEAVKEGGSAEPSADPETEQGQSPEPSAEDAPKPSEDAA
STEEAAKEKQGEAGDASADASEGPDAAAAAAAAAAAAAAAAAAAAAATTDTATTDAAAKDGKEAPADGTKEGEAK
TESNQATEEPLAAEAIEAEESKTEGAAAEDDKSAEAVAEGGKPDEPSAEETVSEQAKAGESAADEGKADAPAEGS
EPDESKGVTAAEGSNAEGSKTDETNVAPAEKDKVEETTTEGDKSEEETKAGVSAADDNKTQETAGEGSKDDETAE
KEMETADPAPVESESQEPVVEKNKTEEAKTDDSTVAEPPVEEKEMDEAKADETLTEQPKTEQSTADENKAKETDV
AGAKTEDAAPQEESEKTTAEEAKTDETVEDATPDEGSETGEVTAKGTETAETTSEKTQVEKGDSAEEAKVRAGDG
DRQDDTANPVETAADKDDEKIENPSPEKATADESARAEADKGDAEEPSSSTGEQAEPQVSAPTDEAGSEVAKTNG
EPERSSTDEKNEPEAGGESKDAVASENVVNGAEEKAGDGAAPSDTGNASTKQVHFAEKDENIPDVNNAHSEDEVS
HAEDSKPLDPPVNGIEAASPAPETTDAAEDTKVTASSSNDPADDAETAGKENGNDEGEEAAPEAGPNAEPDEKPN
HVAEPEASEAEKEQPKSEEAEGVKPTESNPESEGEDIKAVEAGDSAREIAGKNESSADKADEQATQGTDVTPSAG
TEPECASGTADKAGTELAAEEEVKEKQAQESKDGAASEGETEGKGEGADDDDTGCKDDAETETDALSKAEPADAD
AAVQADGDVKPSEDGNPSGATHQASSKDSTGVTADAPTGAGKDESEAAKASDAVDGSEVVVATDKPDEGTDALEE
FPKEHVSAEATNKPDAPEGTQAPKEDAPADAEAPKDNAAEEDASADAEAAKVPDGPAEAEASTTKAPGEETSAEP
ATDAKADESKGAQASSEAEAEARKESEAHVDVKTEESEGTEAAAEAKKDASAETGASTTAEAEAAKDIEATAETE
KPAASSETEAAAPKDPEASTEPEAPAETEASEKQQAPAEAPTEKEAAKVDDAPADSPDEAKAAGEAETVDVPEAG
KEAAAEAEAPAEVKTEAAAGDAVAETAVEAKTEEVPAETAQTEDKPTIEDAPAATASEGTEDPKEADVEAAKEAE
AEAPKDDTPAEAGDEAVEKATPDAAAESAEPAEEKTAVPEPEAEAEADTEQADTEQAEPEQAEPPAPDADEVGAQ
VNGQDEQGEDEAKPSTEEEGVTATEQAAADEQPRETAEDDAEAVPAEGEPDGVSAAEAAAALAGAGAGAGAAAAI
AAAEVHEAAEDESKDTVGPIPGAKGEALARSKKEPANDAAAASKGPLEEQGTDETTDEAAAMRSSTTGIAEDDGL
GSSQELRRAMESIRAVAALGLALMSLGGISLEGQTEASAREHLPLPAWEESSEAATPSVESLETVIISHELRRKR
LLLREAEEMIAAAVIVYAAVEISTSQSPAMDSDPEAQCRDGAELKDDGCDRRADYVADSKRDSGSSSSDKDRNGH
RRRYHHTSRSRGEEAVKESRRRPPSHNSQSSRRSGEDASRAKAKSGRRHDSGYSGESSGSSGWRRRTEEQAEHDG
KKTERRRADDEAAEPERKRSGRRRRTAEEQEEHDGRKAERRRAANEQADQERRKSERRQKEKEAADGHPERSQQR
PSQRRHSHSSSQQPQTPEKRFFDVRNSEGILGRGSPTPPIMGESGSLPSSPHHGPRRSNTSHSKHSSSGGRPSGE
QTRASRSTRSRESNGNGSDENAGPSRQTAENEARRARGQEREKAKKGLRGLMKRLFT*
Coding >Ophcf2|02031
ATGCCGCCGCCAGACGAGGACGAGCCCGCGGGTCAGGATCCAGCGACGGCATCTTCCGAGGGGAAGGCTGGTGAT
GGCGCTGAGAACGGCCAGGAAGCGGCCGCAGACAACGCCGAGGCAGCCGAAGCGAATCAACAAGATGGGAAAGCC
GAGGCCTCGAATGAAACACCTGCTGCTTCGAATGAGGAGCCTCCGGAGTCCACGGACGAGCCAGCTCAAGCTGCC
GACGAGCCGTCAGCTGCTGAGAAGCCCTCGGATTCTCCTCTCACCGAGGATCCAGCTTCGACATCTCAAGAGCCT
GAAGCCTCCAATGCTGGCGATGACAAGAAGGAGGTCGAGGCGGTGAAAGAAGGTGGATCCGCCGAGCCGTCAGCT
GATCCGGAGACGGAACAAGGACAAAGCCCGGAGCCGTCCGCCGAAGACGCGCCAAAGCCCTCAGAAGACGCCGCT
TCGACGGAAGAGGCGGCAAAGGAGAAGCAGGGCGAGGCAGGCGACGCGTCTGCTGATGCAAGCGAGGGTCCCGAT
GCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCACAGAC
ACGGCTACCACCGATGCTGCAGCCAAAGACGGTAAGGAGGCTCCAGCAGACGGCACGAAAGAAGGGGAAGCGAAG
ACGGAGTCGAATCAGGCCACCGAGGAGCCTTTGGCAGCTGAGGCGATCGAGGCCGAGGAGAGCAAGACCGAAGGG
GCGGCGGCCGAAGACGACAAGTCTGCTGAAGCTGTTGCCGAGGGAGGCAAACCGGACGAGCCCAGTGCTGAAGAG
ACTGTTTCCGAGCAGGCCAAAGCTGGAGAGAGTGCAGCTGATGAGGGAAAAGCTGATGCTCCGGCTGAGGGGAGC
GAACCCGACGAATCCAAAGGAGTGACTGCTGCTGAAGGCAGCAATGCTGAAGGAAGCAAGACTGATGAGACAAAT
GTGGCACCAGCCGAGAAGGACAAAGTTGAAGAGACCACGACCGAGGGAGACAAATCCGAAGAGGAGACCAAGGCC
GGGGTCAGTGCAGCCGACGACAACAAGACTCAAGAGACGGCAGGCGAGGGAAGCAAAGACGATGAAACTGCAGAG
AAGGAGATGGAGACTGCAGACCCTGCACCTGTTGAAAGCGAGTCTCAAGAGCCCGTTGTCGAAAAAAACAAGACT
GAAGAGGCCAAGACGGACGACAGCACTGTCGCTGAGCCTCCGGTTGAGGAAAAGGAGATGGACGAAGCCAAAGCG
GACGAGACTCTTACTGAGCAGCCCAAGACTGAGCAGTCGACGGCCGATGAGAACAAGGCTAAAGAGACCGACGTC
GCGGGCGCCAAGACTGAAGATGCTGCACCTCAGGAAGAGAGTGAGAAGACTACAGCCGAGGAGGCCAAGACTGAC
GAGACAGTGGAAGATGCTACACCTGACGAGGGGTCCGAGACTGGAGAAGTCACAGCCAAGGGCACCGAAACCGCA
GAGACTACGTCTGAAAAGACTCAAGTTGAGAAAGGAGATTCAGCAGAGGAAGCCAAAGTTCGCGCCGGGGATGGG
GATCGGCAGGACGATACAGCAAATCCGGTAGAGACGGCGGCTGACAAGGACGATGAAAAGATTGAAAATCCATCG
CCAGAGAAAGCAACAGCAGATGAGTCTGCCCGGGCTGAAGCAGACAAGGGTGACGCAGAAGAGCCATCGTCGTCC
ACAGGCGAACAGGCAGAACCTCAAGTCTCCGCGCCAACAGATGAGGCCGGATCAGAGGTCGCCAAAACGAACGGC
GAGCCAGAGCGATCATCGACTGACGAGAAGAATGAGCCAGAGGCGGGCGGCGAGTCCAAAGACGCTGTCGCTTCA
GAGAATGTAGTCAACGGCGCAGAGGAGAAAGCTGGCGATGGCGCTGCCCCTTCGGATACGGGGAACGCATCGACC
AAGCAGGTTCACTTTGCGGAGAAGGATGAGAATATTCCTGATGTGAACAATGCTCATTCGGAAGATGAAGTCTCT
CACGCGGAGGATAGCAAGCCTTTGGACCCTCCTGTCAATGGCATCGAGGCAGCAAGTCCAGCACCCGAGACGACA
GACGCCGCTGAGGACACCAAAGTTACAGCATCAAGCTCGAATGACCCTGCCGATGACGCCGAAACCGCTGGGAAG
GAGAACGGGAATGATGAGGGAGAAGAAGCGGCCCCCGAGGCTGGTCCGAATGCGGAACCGGACGAAAAGCCGAAC
CATGTTGCTGAACCAGAGGCGTCGGAAGCAGAGAAAGAACAGCCGAAATCTGAAGAGGCTGAAGGCGTCAAGCCT
ACCGAGTCTAACCCTGAGTCAGAAGGCGAGGATATAAAAGCCGTCGAAGCTGGAGATTCGGCACGAGAGATTGCC
GGGAAGAATGAGAGCTCAGCCGACAAAGCTGATGAACAGGCGACTCAAGGTACAGACGTTACTCCCAGCGCGGGA
ACGGAGCCCGAGTGCGCGTCTGGGACGGCAGACAAAGCAGGGACCGAACTTGCTGCCGAGGAAGAGGTCAAGGAA
AAACAAGCTCAAGAGTCCAAGGATGGAGCTGCTTCCGAGGGAGAGACGGAGGGGAAAGGCGAGGGCGCTGATGAT
GATGATACTGGATGCAAGGACGACGCGGAAACTGAGACTGATGCTTTGTCCAAGGCTGAGCCTGCGGACGCTGAT
GCTGCGGTGCAAGCGGATGGAGATGTGAAACCTTCTGAAGATGGCAACCCGTCAGGTGCTACTCACCAGGCCTCG
AGCAAGGACTCTACGGGGGTCACCGCCGATGCGCCGACAGGTGCAGGGAAAGACGAGTCTGAGGCTGCGAAGGCG
TCTGATGCTGTCGATGGCTCTGAAGTGGTTGTGGCGACTGACAAGCCGGACGAGGGGACTGACGCTCTCGAGGAA
TTCCCCAAAGAACATGTTTCTGCCGAGGCGACTAACAAGCCGGATGCCCCTGAGGGAACTCAAGCTCCCAAGGAA
GATGCCCCTGCGGACGCTGAAGCCCCGAAGGATAATGCTGCTGAGGAGGATGCTTCTGCCGACGCAGAGGCCGCG
AAAGTGCCCGATGGTCCTGCAGAGGCGGAAGCCTCGACAACAAAGGCTCCCGGGGAGGAAACCTCTGCTGAACCT
GCTACGGATGCGAAGGCGGATGAGTCCAAGGGAGCTCAAGCCTCTTCTGAAGCTGAAGCAGAGGCACGCAAAGAG
TCCGAAGCACATGTTGACGTCAAGACTGAGGAGTCCGAGGGGACTGAAGCCGCGGCGGAGGCAAAGAAAGATGCA
TCCGCGGAGACTGGAGCTTCTACTACAGCAGAAGCAGAGGCAGCCAAGGATATCGAAGCAACTGCAGAGACTGAG
AAGCCCGCAGCTTCCAGCGAGACGGAGGCTGCGGCGCCCAAGGACCCTGAAGCATCTACAGAGCCCGAAGCTCCC
GCAGAAACGGAGGCTTCTGAGAAACAACAGGCTCCTGCTGAGGCTCCCACCGAGAAAGAGGCTGCCAAGGTGGAC
GACGCGCCCGCAGATTCGCCCGATGAAGCCAAGGCCGCAGGGGAGGCAGAGACGGTTGACGTCCCAGAGGCCGGT
AAGGAGGCAGCGGCGGAAGCTGAAGCACCCGCAGAGGTCAAGACAGAGGCAGCTGCTGGAGATGCTGTCGCTGAG
ACGGCGGTGGAGGCCAAGACTGAAGAAGTTCCCGCAGAGACGGCTCAGACGGAGGATAAGCCGACTATCGAGGAC
GCTCCCGCGGCGACGGCATCAGAGGGGACTGAAGATCCCAAGGAGGCAGATGTGGAGGCTGCCAAGGAAGCGGAA
GCGGAAGCCCCTAAAGACGACACCCCGGCCGAGGCTGGAGATGAGGCCGTCGAGAAAGCCACACCTGATGCAGCA
GCTGAGAGCGCAGAGCCGGCGGAAGAGAAGACGGCCGTGCCAGAACCCGAGGCCGAGGCCGAGGCCGATACGGAG
CAGGCCGACACGGAGCAGGCCGAGCCGGAACAGGCCGAGCCGCCGGCACCTGACGCTGACGAAGTTGGCGCGCAG
GTGAACGGCCAGGACGAGCAAGGCGAGGACGAAGCCAAGCCGTCGACGGAGGAAGAAGGAGTCACAGCTACCGAG
CAAGCTGCAGCAGATGAGCAGCCCAGAGAGACAGCCGAAGACGACGCCGAAGCAGTTCCCGCTGAAGGCGAGCCG
GACGGAGTGTCCGCTGCCGAAGCTGCCGCCGCGCTTGCAGGGGCAGGGGCAGGGGCAGGGGCAGCAGCAGCCATA
GCAGCAGCAGAAGTACACGAGGCGGCAGAAGACGAGAGCAAGGACACGGTCGGACCAATTCCAGGGGCCAAGGGT
GAGGCTCTGGCGAGATCCAAGAAAGAGCCTGCCAATGACGCTGCAGCAGCTTCCAAGGGGCCTCTCGAGGAGCAA
GGAACAGATGAGACGACGGATGAAGCAGCAGCGATGCGATCATCGACTACTGGCATCGCGGAAGATGATGGGCTC
GGCTCATCTCAGGAGCTACGTCGAGCGATGGAGTCCATCAGGGCTGTCGCAGCTTTAGGACTCGCCCTCATGAGC
CTGGGTGGCATATCGCTAGAGGGACAAACTGAGGCCAGCGCCAGGGAGCATCTGCCCCTACCAGCCTGGGAGGAA
AGCTCTGAAGCCGCAACACCGAGTGTCGAATCTCTTGAAACTGTCATCATCAGCCACGAGCTAAGACGGAAGAGG
CTGCTCCTCCGTGAAGCCGAGGAGATGATAGCCGCAGCTGTCATCGTCTACGCAGCAGTCGAAATATCGACTTCT
CAAAGCCCGGCTATGGACTCGGATCCAGAGGCTCAGTGTCGGGACGGGGCTGAACTGAAAGATGACGGATGTGAC
CGGCGCGCTGACTACGTTGCAGACAGTAAACGGGACTCTGGATCGTCGAGCAGCGATAAAGACAGGAACGGGCAC
CGTAGACGATACCACCACACCAGCCGAAGTCGCGGAGAAGAGGCAGTCAAGGAGAGCCGACGACGACCACCGTCA
CATAACTCTCAGTCGTCTCGACGAAGCGGCGAAGATGCAAGCAGGGCCAAGGCGAAATCCGGCCGGCGTCACGAT
AGCGGGTATTCGGGAGAGAGCTCCGGTAGCTCAGGCTGGAGACGGCGCACTGAAGAACAGGCCGAGCACGACGGG
AAGAAGACGGAGCGACGGAGAGCGGACGACGAGGCAGCGGAGCCGGAGAGGAAGAGGAGCGGGCGACGGCGGCGC
ACTGCGGAGGAGCAAGAGGAGCATGATGGGAGAAAGGCCGAGAGAAGACGGGCTGCGAATGAGCAGGCGGATCAG
GAGAGAAGGAAGTCTGAGCGTCGACAGAAGGAAAAGGAAGCGGCAGATGGTCATCCGGAACGCAGCCAGCAGCGG
CCATCGCAACGACGGCACAGCCACTCGAGCAGCCAGCAACCGCAGACTCCAGAGAAGCGATTCTTCGACGTGCGC
AACTCAGAGGGCATCCTCGGGCGCGGATCACCGACGCCACCCATCATGGGCGAGTCCGGAAGCCTCCCATCCTCT
CCGCACCACGGACCGCGACGATCCAACACATCGCACTCGAAGCACAGCAGCAGCGGCGGACGGCCATCGGGCGAA
CAGACGCGGGCGAGCAGATCGACGAGGTCGCGAGAGAGCAACGGTAACGGATCGGACGAGAATGCCGGGCCGAGC
AGGCAGACGGCGGAGAATGAGGCGCGAAGGGCTCGGGGACAGGAGAGGGAGAAGGCGAAGAAGGGGCTTCGGGGG
CTGATGAAGAGATTGTTTACGTGA
Transcript >Ophcf2|02031
ATGCCGCCGCCAGACGAGGACGAGCCCGCGGGTCAGGATCCAGCGACGGCATCTTCCGAGGGGAAGGCTGGTGAT
GGCGCTGAGAACGGCCAGGAAGCGGCCGCAGACAACGCCGAGGCAGCCGAAGCGAATCAACAAGATGGGAAAGCC
GAGGCCTCGAATGAAACACCTGCTGCTTCGAATGAGGAGCCTCCGGAGTCCACGGACGAGCCAGCTCAAGCTGCC
GACGAGCCGTCAGCTGCTGAGAAGCCCTCGGATTCTCCTCTCACCGAGGATCCAGCTTCGACATCTCAAGAGCCT
GAAGCCTCCAATGCTGGCGATGACAAGAAGGAGGTCGAGGCGGTGAAAGAAGGTGGATCCGCCGAGCCGTCAGCT
GATCCGGAGACGGAACAAGGACAAAGCCCGGAGCCGTCCGCCGAAGACGCGCCAAAGCCCTCAGAAGACGCCGCT
TCGACGGAAGAGGCGGCAAAGGAGAAGCAGGGCGAGGCAGGCGACGCGTCTGCTGATGCAAGCGAGGGTCCCGAT
GCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCACAGAC
ACGGCTACCACCGATGCTGCAGCCAAAGACGGTAAGGAGGCTCCAGCAGACGGCACGAAAGAAGGGGAAGCGAAG
ACGGAGTCGAATCAGGCCACCGAGGAGCCTTTGGCAGCTGAGGCGATCGAGGCCGAGGAGAGCAAGACCGAAGGG
GCGGCGGCCGAAGACGACAAGTCTGCTGAAGCTGTTGCCGAGGGAGGCAAACCGGACGAGCCCAGTGCTGAAGAG
ACTGTTTCCGAGCAGGCCAAAGCTGGAGAGAGTGCAGCTGATGAGGGAAAAGCTGATGCTCCGGCTGAGGGGAGC
GAACCCGACGAATCCAAAGGAGTGACTGCTGCTGAAGGCAGCAATGCTGAAGGAAGCAAGACTGATGAGACAAAT
GTGGCACCAGCCGAGAAGGACAAAGTTGAAGAGACCACGACCGAGGGAGACAAATCCGAAGAGGAGACCAAGGCC
GGGGTCAGTGCAGCCGACGACAACAAGACTCAAGAGACGGCAGGCGAGGGAAGCAAAGACGATGAAACTGCAGAG
AAGGAGATGGAGACTGCAGACCCTGCACCTGTTGAAAGCGAGTCTCAAGAGCCCGTTGTCGAAAAAAACAAGACT
GAAGAGGCCAAGACGGACGACAGCACTGTCGCTGAGCCTCCGGTTGAGGAAAAGGAGATGGACGAAGCCAAAGCG
GACGAGACTCTTACTGAGCAGCCCAAGACTGAGCAGTCGACGGCCGATGAGAACAAGGCTAAAGAGACCGACGTC
GCGGGCGCCAAGACTGAAGATGCTGCACCTCAGGAAGAGAGTGAGAAGACTACAGCCGAGGAGGCCAAGACTGAC
GAGACAGTGGAAGATGCTACACCTGACGAGGGGTCCGAGACTGGAGAAGTCACAGCCAAGGGCACCGAAACCGCA
GAGACTACGTCTGAAAAGACTCAAGTTGAGAAAGGAGATTCAGCAGAGGAAGCCAAAGTTCGCGCCGGGGATGGG
GATCGGCAGGACGATACAGCAAATCCGGTAGAGACGGCGGCTGACAAGGACGATGAAAAGATTGAAAATCCATCG
CCAGAGAAAGCAACAGCAGATGAGTCTGCCCGGGCTGAAGCAGACAAGGGTGACGCAGAAGAGCCATCGTCGTCC
ACAGGCGAACAGGCAGAACCTCAAGTCTCCGCGCCAACAGATGAGGCCGGATCAGAGGTCGCCAAAACGAACGGC
GAGCCAGAGCGATCATCGACTGACGAGAAGAATGAGCCAGAGGCGGGCGGCGAGTCCAAAGACGCTGTCGCTTCA
GAGAATGTAGTCAACGGCGCAGAGGAGAAAGCTGGCGATGGCGCTGCCCCTTCGGATACGGGGAACGCATCGACC
AAGCAGGTTCACTTTGCGGAGAAGGATGAGAATATTCCTGATGTGAACAATGCTCATTCGGAAGATGAAGTCTCT
CACGCGGAGGATAGCAAGCCTTTGGACCCTCCTGTCAATGGCATCGAGGCAGCAAGTCCAGCACCCGAGACGACA
GACGCCGCTGAGGACACCAAAGTTACAGCATCAAGCTCGAATGACCCTGCCGATGACGCCGAAACCGCTGGGAAG
GAGAACGGGAATGATGAGGGAGAAGAAGCGGCCCCCGAGGCTGGTCCGAATGCGGAACCGGACGAAAAGCCGAAC
CATGTTGCTGAACCAGAGGCGTCGGAAGCAGAGAAAGAACAGCCGAAATCTGAAGAGGCTGAAGGCGTCAAGCCT
ACCGAGTCTAACCCTGAGTCAGAAGGCGAGGATATAAAAGCCGTCGAAGCTGGAGATTCGGCACGAGAGATTGCC
GGGAAGAATGAGAGCTCAGCCGACAAAGCTGATGAACAGGCGACTCAAGGTACAGACGTTACTCCCAGCGCGGGA
ACGGAGCCCGAGTGCGCGTCTGGGACGGCAGACAAAGCAGGGACCGAACTTGCTGCCGAGGAAGAGGTCAAGGAA
AAACAAGCTCAAGAGTCCAAGGATGGAGCTGCTTCCGAGGGAGAGACGGAGGGGAAAGGCGAGGGCGCTGATGAT
GATGATACTGGATGCAAGGACGACGCGGAAACTGAGACTGATGCTTTGTCCAAGGCTGAGCCTGCGGACGCTGAT
GCTGCGGTGCAAGCGGATGGAGATGTGAAACCTTCTGAAGATGGCAACCCGTCAGGTGCTACTCACCAGGCCTCG
AGCAAGGACTCTACGGGGGTCACCGCCGATGCGCCGACAGGTGCAGGGAAAGACGAGTCTGAGGCTGCGAAGGCG
TCTGATGCTGTCGATGGCTCTGAAGTGGTTGTGGCGACTGACAAGCCGGACGAGGGGACTGACGCTCTCGAGGAA
TTCCCCAAAGAACATGTTTCTGCCGAGGCGACTAACAAGCCGGATGCCCCTGAGGGAACTCAAGCTCCCAAGGAA
GATGCCCCTGCGGACGCTGAAGCCCCGAAGGATAATGCTGCTGAGGAGGATGCTTCTGCCGACGCAGAGGCCGCG
AAAGTGCCCGATGGTCCTGCAGAGGCGGAAGCCTCGACAACAAAGGCTCCCGGGGAGGAAACCTCTGCTGAACCT
GCTACGGATGCGAAGGCGGATGAGTCCAAGGGAGCTCAAGCCTCTTCTGAAGCTGAAGCAGAGGCACGCAAAGAG
TCCGAAGCACATGTTGACGTCAAGACTGAGGAGTCCGAGGGGACTGAAGCCGCGGCGGAGGCAAAGAAAGATGCA
TCCGCGGAGACTGGAGCTTCTACTACAGCAGAAGCAGAGGCAGCCAAGGATATCGAAGCAACTGCAGAGACTGAG
AAGCCCGCAGCTTCCAGCGAGACGGAGGCTGCGGCGCCCAAGGACCCTGAAGCATCTACAGAGCCCGAAGCTCCC
GCAGAAACGGAGGCTTCTGAGAAACAACAGGCTCCTGCTGAGGCTCCCACCGAGAAAGAGGCTGCCAAGGTGGAC
GACGCGCCCGCAGATTCGCCCGATGAAGCCAAGGCCGCAGGGGAGGCAGAGACGGTTGACGTCCCAGAGGCCGGT
AAGGAGGCAGCGGCGGAAGCTGAAGCACCCGCAGAGGTCAAGACAGAGGCAGCTGCTGGAGATGCTGTCGCTGAG
ACGGCGGTGGAGGCCAAGACTGAAGAAGTTCCCGCAGAGACGGCTCAGACGGAGGATAAGCCGACTATCGAGGAC
GCTCCCGCGGCGACGGCATCAGAGGGGACTGAAGATCCCAAGGAGGCAGATGTGGAGGCTGCCAAGGAAGCGGAA
GCGGAAGCCCCTAAAGACGACACCCCGGCCGAGGCTGGAGATGAGGCCGTCGAGAAAGCCACACCTGATGCAGCA
GCTGAGAGCGCAGAGCCGGCGGAAGAGAAGACGGCCGTGCCAGAACCCGAGGCCGAGGCCGAGGCCGATACGGAG
CAGGCCGACACGGAGCAGGCCGAGCCGGAACAGGCCGAGCCGCCGGCACCTGACGCTGACGAAGTTGGCGCGCAG
GTGAACGGCCAGGACGAGCAAGGCGAGGACGAAGCCAAGCCGTCGACGGAGGAAGAAGGAGTCACAGCTACCGAG
CAAGCTGCAGCAGATGAGCAGCCCAGAGAGACAGCCGAAGACGACGCCGAAGCAGTTCCCGCTGAAGGCGAGCCG
GACGGAGTGTCCGCTGCCGAAGCTGCCGCCGCGCTTGCAGGGGCAGGGGCAGGGGCAGGGGCAGCAGCAGCCATA
GCAGCAGCAGAAGTACACGAGGCGGCAGAAGACGAGAGCAAGGACACGGTCGGACCAATTCCAGGGGCCAAGGGT
GAGGCTCTGGCGAGATCCAAGAAAGAGCCTGCCAATGACGCTGCAGCAGCTTCCAAGGGGCCTCTCGAGGAGCAA
GGAACAGATGAGACGACGGATGAAGCAGCAGCGATGCGATCATCGACTACTGGCATCGCGGAAGATGATGGGCTC
GGCTCATCTCAGGAGCTACGTCGAGCGATGGAGTCCATCAGGGCTGTCGCAGCTTTAGGACTCGCCCTCATGAGC
CTGGGTGGCATATCGCTAGAGGGACAAACTGAGGCCAGCGCCAGGGAGCATCTGCCCCTACCAGCCTGGGAGGAA
AGCTCTGAAGCCGCAACACCGAGTGTCGAATCTCTTGAAACTGTCATCATCAGCCACGAGCTAAGACGGAAGAGG
CTGCTCCTCCGTGAAGCCGAGGAGATGATAGCCGCAGCTGTCATCGTCTACGCAGCAGTCGAAATATCGACTTCT
CAAAGCCCGGCTATGGACTCGGATCCAGAGGCTCAGTGTCGGGACGGGGCTGAACTGAAAGATGACGGATGTGAC
CGGCGCGCTGACTACGTTGCAGACAGTAAACGGGACTCTGGATCGTCGAGCAGCGATAAAGACAGGAACGGGCAC
CGTAGACGATACCACCACACCAGCCGAAGTCGCGGAGAAGAGGCAGTCAAGGAGAGCCGACGACGACCACCGTCA
CATAACTCTCAGTCGTCTCGACGAAGCGGCGAAGATGCAAGCAGGGCCAAGGCGAAATCCGGCCGGCGTCACGAT
AGCGGGTATTCGGGAGAGAGCTCCGGTAGCTCAGGCTGGAGACGGCGCACTGAAGAACAGGCCGAGCACGACGGG
AAGAAGACGGAGCGACGGAGAGCGGACGACGAGGCAGCGGAGCCGGAGAGGAAGAGGAGCGGGCGACGGCGGCGC
ACTGCGGAGGAGCAAGAGGAGCATGATGGGAGAAAGGCCGAGAGAAGACGGGCTGCGAATGAGCAGGCGGATCAG
GAGAGAAGGAAGTCTGAGCGTCGACAGAAGGAAAAGGAAGCGGCAGATGGTCATCCGGAACGCAGCCAGCAGCGG
CCATCGCAACGACGGCACAGCCACTCGAGCAGCCAGCAACCGCAGACTCCAGAGAAGCGATTCTTCGACGTGCGC
AACTCAGAGGGCATCCTCGGGCGCGGATCACCGACGCCACCCATCATGGGCGAGTCCGGAAGCCTCCCATCCTCT
CCGCACCACGGACCGCGACGATCCAACACATCGCACTCGAAGCACAGCAGCAGCGGCGGACGGCCATCGGGCGAA
CAGACGCGGGCGAGCAGATCGACGAGGTCGCGAGAGAGCAACGGTAACGGATCGGACGAGAATGCCGGGCCGAGC
AGGCAGACGGCGGAGAATGAGGCGCGAAGGGCTCGGGGACAGGAGAGGGAGAAGGCGAAGAAGGGGCTTCGGGGG
CTGATGAAGAGATTGTTTACGTGA
Gene >Ophcf2|02031
ATGCCGCCGCCAGTGAGTCAGCAGCAGCTCGTGATAGCAAAGAAGTCGACAGTCCGATAAAGGACGAGGACGAGC
CCGCGGGTCAGGATCCAGCGACGGCATCTTCCGAGGGGAAGGCTGGTGATGGCGCTGAGAACGGCCAGGAAGCGG
CCGCAGACAACGCCGAGGCAGCCGAAGCGAATCAACAAGATGGGAAAGCCGAGGCCTCGAATGAAACACCTGCTG
CTTCGAATGAGGAGCCTCCGGAGTCCACGGACGAGCCAGCTCAAGCTGCCGACGAGCCGTCAGCTGCTGAGAAGC
CCTCGGATTCTCCTCTCACCGAGGATCCAGCTTCGACATCTCAAGAGCCTGAAGCCTCCAATGCTGGCGATGACA
AGAAGGAGGTCGAGGCGGTGAAAGAAGGTGGATCCGCCGAGCCGTCAGCTGATCCGGAGACGGAACAAGGACAAA
GCCCGGAGCCGTCCGCCGAAGACGCGCCAAAGCCCTCAGAAGACGCCGCTTCGACGGAAGAGGCGGCAAAGGAGA
AGCAGGGCGAGGCAGGCGACGCGTCTGCTGATGCAAGCGAGGGTCCCGATGCTGCTGCTGCTGCTGCTGCTGCTG
CTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCACAGACACGGCTACCACCGATGCTGCAGCCA
AAGACGGTAAGGAGGCTCCAGCAGACGGCACGAAAGAAGGGGAAGCGAAGACGGAGTCGAATCAGGCCACCGAGG
AGCCTTTGGCAGCTGAGGCGATCGAGGCCGAGGAGAGCAAGACCGAAGGGGCGGCGGCCGAAGACGACAAGTCTG
CTGAAGCTGTTGCCGAGGGAGGCAAACCGGACGAGCCCAGTGCTGAAGAGACTGTTTCCGAGCAGGCCAAAGCTG
GAGAGAGTGCAGCTGATGAGGGAAAAGCTGATGCTCCGGCTGAGGGGAGCGAACCCGACGAATCCAAAGGAGTGA
CTGCTGCTGAAGGCAGCAATGCTGAAGGAAGCAAGACTGATGAGACAAATGTGGCACCAGCCGAGAAGGACAAAG
TTGAAGAGACCACGACCGAGGGAGACAAATCCGAAGAGGAGACCAAGGCCGGGGTCAGTGCAGCCGACGACAACA
AGACTCAAGAGACGGCAGGCGAGGGAAGCAAAGACGATGAAACTGCAGAGAAGGAGATGGAGACTGCAGACCCTG
CACCTGTTGAAAGCGAGTCTCAAGAGCCCGTTGTCGAAAAAAACAAGACTGAAGAGGCCAAGACGGACGACAGCA
CTGTCGCTGAGCCTCCGGTTGAGGAAAAGGAGATGGACGAAGCCAAAGCGGACGAGACTCTTACTGAGCAGCCCA
AGACTGAGCAGTCGACGGCCGATGAGAACAAGGCTAAAGAGACCGACGTCGCGGGCGCCAAGACTGAAGATGCTG
CACCTCAGGAAGAGAGTGAGAAGACTACAGCCGAGGAGGCCAAGACTGACGAGACAGTGGGTGAGAAGACACCAT
CGGAGACCGAGACTAAAGAACGCGCAGTTGCTGAGGCCAAGGCAGAAGATGCTACACCTGACGAGGGGTCCGAGA
CTGGAGAAGTCACAGCCAAGGGCACCGAAACCGCAGAGACTACGTCTGAAAAGACTCAAGTTGAGAAAGGAGATT
CAGCAGAGGAAGCCAAAGTTCGCGCCGGGGATGGGGATCGGCAGGACGATACAGCAAATCCGGTAGAGACGGCGG
CTGACAAGGACGATGAAAAGATTGAAAATCCATCGCCAGAGAAAGCAACAGCAGATGAGTCTGCCCGGGCTGAAG
CAGACAAGGGTGACGCAGAAGAGCCATCGTCGTCCACAGGCGAACAGGCAGAACCTCAAGTCTCCGCGCCAACAG
ATGAGGCCGGATCAGAGGTCGCCAAAACGAACGGCGAGCCAGAGCGATCATCGACTGACGAGAAGAATGAGCCAG
AGGCGGGCGGCGAGTCCAAAGACGCTGTCGCTTCAGAGAATGTAGTCAACGGCGCAGAGGAGAAAGCTGGCGATG
GCGCTGCCCCTTCGGATACGGGGAACGCATCGACCAAGCAGGTTCACTTTGCGGAGAAGGATGAGAATATTCCTG
ATGTGAACAATGCTCATTCGGAAGATGAAGTCTCTCACGCGGAGGATAGCAAGCCTTTGGACCCTCCTGTCAATG
GCATCGAGGCAGCAAGTCCAGCACCCGAGACGACAGACGCCGCTGAGGACACCAAAGTTACAGCATCAAGCTCGA
ATGACCCTGCCGATGACGCCGAAACCGCTGGGAAGGAGAACGGGAATGATGAGGGAGAAGAAGCGGCCCCCGAGG
CTGGTCCGAATGCGGAACCGGACGAAAAGCCGAACCATGTTGCTGAACCAGAGGCGTCGGAAGCAGAGAAAGAAC
AGCCGAAATCTGAAGAGGCTGAAGGCGTCAAGCCTACCGAGTCTAACCCTGAGTCAGAAGGCGAGGATATAAAAG
CCGTCGAAGCTGGAGATTCGGCACGAGAGATTGCCGGGAAGAATGAGAGCTCAGCCGACAAAGCTGATGAACAGG
CGACTCAAGGTACAGACGTTACTCCCAGCGCGGGAACGGAGCCCGAGTGCGCGTCTGGGACGGCAGACAAAGCAG
GGACCGAACTTGCTGCCGAGGAAGAGGTCAAGGAAAAACAAGCTCAAGAGTCCAAGGATGGAGCTGCTTCCGAGG
GAGAGACGGAGGGGAAAGGCGAGGGCGCTGATGATGATGATACTGGATGCAAGGACGACGCGGAAACTGAGACTG
ATGCTTTGTCCAAGGCTGAGCCTGCGGACGCTGATGCTGCGGTGCAAGCGGATGGAGATGTGAAACCTTCTGAAG
ATGGCAACCCGTCAGGTGCTACTCACCAGGCCTCGAGCAAGGACTCTACGGGGGTCACCGCCGATGCGCCGACAG
GTGCAGGGAAAGACGAGTCTGAGGCTGCGAAGGCGTCTGATGCTGTCGATGGCTCTGAAGTGGTTGTGGCGACTG
ACAAGCCGGACGAGGGGACTGACGCTCTCGAGGAATTCCCCAAAGAACATGTTTCTGCCGAGGCGACTAACAAGC
CGGATGCCCCTGAGGGAACTCAAGCTCCCAAGGAAGATGCCCCTGCGGACGCTGAAGCCCCGAAGGATAATGCTG
CTGAGGAGGATGCTTCTGCCGACGCAGAGGCCGCGAAAGTGCCCGATGGTCCTGCAGAGGCGGAAGCCTCGACAA
CAAAGGCTCCCGGGGAGGAAACCTCTGCTGAACCTGCTACGGATGCGAAGGCGGATGAGTCCAAGGGAGCTCAAG
CCTCTTCTGAAGCTGAAGCAGAGGCACGCAAAGAGTCCGAAGCACATGTTGACGTCAAGACTGAGGAGTCCGAGG
GGACTGAAGCCGCGGCGGAGGCAAAGAAAGATGCATCCGCGGAGACTGGAGCTTCTACTACAGCAGAAGCAGAGG
CAGCCAAGGATATCGAAGCAACTGCAGAGACTGAGAAGCCCGCAGCTTCCAGCGAGACGGAGGCTGCGGCGCCCA
AGGACCCTGAAGCATCTACAGAGCCCGAAGCTCCCGCAGAAACGGAGGCTTCTGAGAAACAACAGGCTCCTGCTG
AGGCTCCCACCGAGAAAGAGGCTGCCAAGGTGGACGACGCGCCCGCAGATTCGCCCGATGAAGCCAAGGCCGCAG
GGGAGGCAGAGACGGTTGACGTCCCAGAGGCCGGTAAGGAGGCAGCGGCGGAAGCTGAAGCACCCGCAGAGGTCA
AGACAGAGGCAGCTGCTGGAGATGCTGTCGCTGAGACGGCGGTGGAGGCCAAGACTGAAGAAGTTCCCGCAGAGA
CGGCTCAGACGGAGGATAAGCCGACTATCGAGGACGCTCCCGCGGCGACGGCATCAGAGGGGACTGAAGATCCCA
AGGAGGCAGATGTGGAGGCTGCCAAGGAAGCGGAAGCGGAAGCCCCTAAAGACGACACCCCGGCCGAGGCTGGAG
ATGAGGCCGTCGAGAAAGCCACACCTGATGCAGCAGCTGAGAGCGCAGAGCCGGCGGAAGAGAAGACGGCCGTGC
CAGAACCCGAGGCCGAGGCCGAGGCCGATACGGAGCAGGCCGACACGGAGCAGGCCGAGCCGGAACAGGCCGAGC
CGCCGGCACCTGACGCTGACGAAGTTGGCGCGCAGGTGAACGGCCAGGACGAGCAAGGCGAGGACGAAGCCAAGC
CGTCGACGGAGGAAGAAGGAGTCACAGCTACCGAGCAAGCTGCAGCAGATGAGCAGCCCAGAGAGACAGCCGAAG
ACGACGCCGAAGCAGTTCCCGCTGAAGGCGAGCCGGACGGAGTGTCCGCTGCCGAAGCTGCCGCCGCGCTTGCAG
GGGCAGGGGCAGGGGCAGGGGCAGCAGCAGCCATAGCAGCAGCAGAAGTACACGAGGCGGCAGAAGACGAGAGCA
AGGACACGGTCGGACCAATTCCAGGGGCCAAGGGTGAGGCTCTGGCGAGATCCAAGAAAGGTAAGGAGCCCAGTT
CCTTCATGGCGTGTTTGGGGAGAGCTCTCTTCTGGGTTCATTGGGTTTGGAGGAGAAGAGGTCGACTGTGGACGT
GGAGGCTGGAAAGGTCGAGATTGCCCTGGACGACTCTGCGATGCTGGCTTCGAGGCCGAGCTGCGAGCAGCCTTT
GATACCGGCTTAGCTGCTACCATGGCGTTTCTCGGACGTCTAAAATCAGCCCTCTTATACCGTTCTCATACCGAT
GCCGTCTTGAGAGCCTGCCAATGACGCTGCAGCAGCTTCCAAGGGGCCTCTCGAGGAGCAAGGAACAGATGAGAC
GACGGATGAAGCAGCAGCGATGCGATCATCGACTACTGGCATCGCGGAAGATGATGGGCTCGGCTCATCTCAGGA
GCTACGTCGAGCGATGGAGTCCATCAGGGCTGTCGCAGCTTTAGGACTCGCCCTCATGAGCCTGGGTGGCATATC
GCTAGAGGGACAAACTGAGGCCAGCGCCAGGGAGCATCTGCCCCTACCAGCCTGGGAGGAAAGCTCTGAAGCCGC
AACACCGAGTGTCGAATCTCTTGAAACTGTCATCATCAGCCACGAGCTAAGACGGAAGAGGCTGCTCCTCCGTGA
AGCCGAGGAGATGATAGCCGCAGCTGTCATCGTCTACGCAGCAGTCGAAATATCGACTTCTCAAAGCCCGGCTAT
GGACTCGGATCCAGAGGCTCAGTGTCGGGACGGGGCTGAACTGAAAGATGACGGATGTGACCGGCGCGCTGACTA
CGTTGCAGACAGTAAACGGGACTCTGGATCGTCGAGCAGCGATAAAGACAGGAACGGGCACCGTAGACGATACCA
CCACACCAGCCGAAGTCGCGGAGAAGAGGCAGTCAAGGAGAGCCGACGACGACCACCGTCACATAACTCTCAGTC
GTCTCGACGAAGCGGCGAAGATGCAAGCAGGGCCAAGGCGAAATCCGGCCGGCGTCACGATAGCGGGTATTCGGG
AGAGAGCTCCGGTAGCTCAGGCTGGAGACGGCGCACTGAAGAACAGGCCGAGCACGACGGGAAGAAGACGGAGCG
ACGGAGAGCGGACGACGAGGCAGCGGAGCCGGAGAGGAAGAGGAGCGGGCGACGGCGGCGCACTGCGGAGGAGCA
AGAGGAGCATGATGGGAGAAAGGCCGAGAGAAGACGGGCTGCGAATGAGCAGGCGGATCAGGAGAGAAGGAAGTC
TGAGCGTCGACAGAAGGAAAAGGAAGCGGCAGATGGTCATCCGGAACGCAGCCAGCAGCGGCCATCGCAACGACG
GCACAGCCACTCGAGCAGCCAGCAACCGCAGACTCCAGAGAAGCGATTCTTCGACGTGCGCAACTCAGAGGGCAT
CCTCGGGCGCGGATCACCGACGCCACCCATCATGGGCGAGTCCGGAAGCCTCCCATCCTCTCCGCACCACGGACC
GCGACGATCCAACACATCGCACTCGAAGCACAGCAGCAGCGGCGGACGGCCATCGGGCGAACAGACGCGGGCGAG
CAGATCGACGAGGTCGCGAGAGAGCAACGGTAACGGATCGGACGAGAATGCCGGGCCGAGCAGGCAGACGGCGGA
GAATGAGGCGCGAAGGGCTCGGGGACAGGAGAGGGAGAAGGCGAAGAAGGGGCTTCGGGGGCTGATGAAGAGATT
GTTTACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail