Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02015
Gene name
Locationscaffold_02:2373324..2377076
Strand+
Gene length (bp)3752
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10419 TFIIIC_sub6 TFIIIC subunit triple barrel domain 2.0E-25 41 282
PF06101 Vps62 Vacuolar protein sorting-associated protein 62 1.6E-09 573 636

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1932 0.2351 0.4001 0.1639 0.1823 0.0649 0.7734 0.5571 0.6187 0.1248

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup797
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1863
Ophiocordyceps australis map64 (Brazil) OphauB2|7338
Ophiocordyceps camponoti-floridani Ophcf2|02015 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4309
Ophiocordyceps kimflemingae Ophio5|3321
Ophiocordyceps subramaniannii Hirsu2|3392
Ophiocordyceps subramaniannii Hirsu2|4092

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02015
MVSSTGEGAEPDEAGALSVEELLRQLEHDDQEEWEYEYSATETETFYLTIDLSYPEFKGQSTLVPPHHRGAYYKG
ETDPTTWADPAVAKDSGRAGGVLSDDEEDAAKDDENEDENDGDNEGEDRVMMDAPAEGGRKDKGKGKEVRPREND
DDDQDKDQDMDEDAPLVDPALKTVVVETESGSRAADKGKQKARDEGAERSYGDENQDDDNQQLEDIQILDLHSPR
PLFSYRGRVFEGQWAEVIGTEAILTHHDDKEALPALRQLAEGIDMLAASSSRIVTTEKLVRPKVAQVDTLAPVRE
EWNIRIPAGKSRTQEKMQQVRFLENLMALKKKKGQEDQVTVFATDGAGKDWNDKHAVDYKPRYRKRTTAMGADDD
DDDDDDDTDEEEVEDEDPDSRRRRRLRQQQRRRRRRAARARAASGRWLRGGLVLATVLACFCFLAWFVPRALNPT
ETSPGRQLEDKLWIETSPYFWDRVAYIAHHLQHMKATDDHGNPLHHGLENINLDGLDHLDAGAHHVNLHSLDDVE
SPGHKPNSTGHSQAPSTLILVDKGNGILDAFWFFFYSYNLGQTVLGLRFGNHVGDWEHCMVRFQHGVPRGIYLSE
HEGGQAYAWSAVEKRGGRPVVYSALGSHAMYALAGNHPYVLPFSLLKDVTDRGPRWDPALNMRAYHYDYLRPLDG
LSPAATNPDAPTGWFHYRGRWGDAVYALADSRQWRLFGQYHYVAGPAGPKFKHLERSKLCSGSRCRLLYELDPEG
TWY*
Coding >Ophcf2|02015
ATGGTGTCTTCGACTGGCGAAGGCGCGGAACCCGACGAAGCCGGCGCCCTGTCGGTTGAAGAACTGCTGCGGCAG
TTGGAGCACGATGATCAGGAGGAGTGGGAGTACGAGTATTCGGCTACGGAAACCGAGACCTTTTACCTCACAATC
GACCTATCGTACCCCGAGTTCAAGGGACAGTCTACTCTGGTGCCGCCTCATCACCGGGGAGCCTACTACAAGGGC
GAGACGGACCCGACGACCTGGGCGGACCCGGCGGTAGCAAAAGACTCGGGTCGGGCGGGCGGCGTGCTCAGCGAT
GACGAGGAAGATGCGGCCAAAGACGACGAGAACGAGGACGAGAACGACGGTGACAACGAGGGCGAGGACCGTGTC
ATGATGGATGCGCCGGCCGAAGGGGGTCGGAAGGATAAGGGGAAAGGAAAGGAGGTGCGGCCAAGAGAGAATGAT
GATGACGACCAGGACAAGGATCAAGACATGGACGAGGATGCGCCGCTTGTTGATCCCGCGCTCAAGACGGTAGTT
GTCGAGACGGAGAGTGGCAGTCGAGCGGCAGACAAGGGGAAGCAAAAGGCACGAGACGAGGGAGCGGAACGCAGC
TACGGAGACGAAAACCAAGACGATGACAACCAGCAGCTCGAAGACATACAGATACTAGACCTGCACTCCCCGCGG
CCTCTCTTCTCATACCGAGGCCGCGTGTTTGAAGGACAATGGGCCGAAGTCATCGGCACAGAAGCCATCCTGACA
CACCACGACGACAAGGAGGCACTGCCGGCACTCCGACAACTAGCAGAGGGAATCGACATGCTAGCGGCGAGCTCG
TCGCGCATCGTTACAACGGAAAAGCTAGTCAGGCCCAAGGTAGCCCAAGTGGACACGCTGGCGCCGGTGCGCGAA
GAGTGGAACATCCGGATCCCGGCGGGCAAGAGCCGGACACAGGAGAAGATGCAGCAGGTGCGCTTCCTCGAGAAC
CTGATGGCGCTGAAGAAGAAGAAGGGGCAGGAAGATCAGGTGACGGTATTCGCCACGGACGGCGCGGGCAAAGAC
TGGAACGACAAGCACGCTGTCGACTACAAGCCGCGATATAGAAAGCGGACGACGGCGATGGGGGCAGACGACGAC
GACGACGACGACGACGACGACACCGACGAAGAAGAGGTGGAGGACGAGGACCCGGATAGCAGGCGGAGGAGACGG
CTGAGACAACAGCAGCGGAGACGACGGCGACGGGCAGCGAGGGCGAGAGCCGCATCGGGACGGTGGTTGCGCGGC
GGCCTCGTGCTGGCGACGGTGTTGGCGTGCTTCTGCTTCCTGGCCTGGTTCGTTCCGCGGGCGCTGAACCCGACG
GAGACGAGTCCTGGGAGGCAGCTGGAGGATAAGCTTTGGATCGAGACGAGTCCTTATTTCTGGGATCGCGTCGCG
TATATAGCCCATCACCTCCAGCACATGAAGGCGACAGATGACCACGGAAACCCTCTTCACCACGGCCTCGAAAAC
ATCAACCTCGATGGACTCGACCATCTCGACGCGGGAGCCCACCACGTCAACCTCCACAGCTTGGACGACGTCGAG
TCTCCCGGCCACAAGCCCAACTCGACCGGCCACTCGCAAGCGCCCTCAACCCTCATCCTCGTCGACAAAGGCAAC
GGCATCCTCGACGCCTTCTGGTTCTTCTTCTACTCGTACAACCTCGGCCAAACCGTGCTCGGCCTCCGGTTCGGA
AACCACGTCGGCGACTGGGAGCACTGCATGGTGCGCTTCCAGCATGGCGTTCCCCGCGGCATTTACCTCTCCGAG
CATGAGGGTGGGCAGGCTTATGCTTGGTCGGCCGTCGAGAAGAGGGGGGGGAGACCGGTTGTTTACTCGGCCTTG
GGTTCCCATGCCATGTACGCCCTCGCTGGGAATCACCCCTACGTCCTCCCCTTTTCGCTACTCAAGGACGTTACC
GATCGGGGACCGCGATGGGATCCAGCCTTGAACATGCGGGCCTATCACTACGATTACCTCCGTCCTCTAGACGGC
CTCTCCCCCGCGGCCACCAACCCGGATGCCCCGACAGGCTGGTTCCATTACCGCGGCCGCTGGGGCGACGCCGTC
TACGCCCTGGCCGATTCCCGCCAGTGGCGTCTCTTCGGGCAGTACCACTACGTTGCCGGACCGGCCGGACCCAAG
TTTAAGCACCTTGAACGGTCCAAGCTGTGCTCCGGCTCGCGGTGCAGGTTGTTGTACGAGTTGGATCCCGAGGGG
ACGTGGTACTGA
Transcript >Ophcf2|02015
ATGGTGTCTTCGACTGGCGAAGGCGCGGAACCCGACGAAGCCGGCGCCCTGTCGGTTGAAGAACTGCTGCGGCAG
TTGGAGCACGATGATCAGGAGGAGTGGGAGTACGAGTATTCGGCTACGGAAACCGAGACCTTTTACCTCACAATC
GACCTATCGTACCCCGAGTTCAAGGGACAGTCTACTCTGGTGCCGCCTCATCACCGGGGAGCCTACTACAAGGGC
GAGACGGACCCGACGACCTGGGCGGACCCGGCGGTAGCAAAAGACTCGGGTCGGGCGGGCGGCGTGCTCAGCGAT
GACGAGGAAGATGCGGCCAAAGACGACGAGAACGAGGACGAGAACGACGGTGACAACGAGGGCGAGGACCGTGTC
ATGATGGATGCGCCGGCCGAAGGGGGTCGGAAGGATAAGGGGAAAGGAAAGGAGGTGCGGCCAAGAGAGAATGAT
GATGACGACCAGGACAAGGATCAAGACATGGACGAGGATGCGCCGCTTGTTGATCCCGCGCTCAAGACGGTAGTT
GTCGAGACGGAGAGTGGCAGTCGAGCGGCAGACAAGGGGAAGCAAAAGGCACGAGACGAGGGAGCGGAACGCAGC
TACGGAGACGAAAACCAAGACGATGACAACCAGCAGCTCGAAGACATACAGATACTAGACCTGCACTCCCCGCGG
CCTCTCTTCTCATACCGAGGCCGCGTGTTTGAAGGACAATGGGCCGAAGTCATCGGCACAGAAGCCATCCTGACA
CACCACGACGACAAGGAGGCACTGCCGGCACTCCGACAACTAGCAGAGGGAATCGACATGCTAGCGGCGAGCTCG
TCGCGCATCGTTACAACGGAAAAGCTAGTCAGGCCCAAGGTAGCCCAAGTGGACACGCTGGCGCCGGTGCGCGAA
GAGTGGAACATCCGGATCCCGGCGGGCAAGAGCCGGACACAGGAGAAGATGCAGCAGGTGCGCTTCCTCGAGAAC
CTGATGGCGCTGAAGAAGAAGAAGGGGCAGGAAGATCAGGTGACGGTATTCGCCACGGACGGCGCGGGCAAAGAC
TGGAACGACAAGCACGCTGTCGACTACAAGCCGCGATATAGAAAGCGGACGACGGCGATGGGGGCAGACGACGAC
GACGACGACGACGACGACGACACCGACGAAGAAGAGGTGGAGGACGAGGACCCGGATAGCAGGCGGAGGAGACGG
CTGAGACAACAGCAGCGGAGACGACGGCGACGGGCAGCGAGGGCGAGAGCCGCATCGGGACGGTGGTTGCGCGGC
GGCCTCGTGCTGGCGACGGTGTTGGCGTGCTTCTGCTTCCTGGCCTGGTTCGTTCCGCGGGCGCTGAACCCGACG
GAGACGAGTCCTGGGAGGCAGCTGGAGGATAAGCTTTGGATCGAGACGAGTCCTTATTTCTGGGATCGCGTCGCG
TATATAGCCCATCACCTCCAGCACATGAAGGCGACAGATGACCACGGAAACCCTCTTCACCACGGCCTCGAAAAC
ATCAACCTCGATGGACTCGACCATCTCGACGCGGGAGCCCACCACGTCAACCTCCACAGCTTGGACGACGTCGAG
TCTCCCGGCCACAAGCCCAACTCGACCGGCCACTCGCAAGCGCCCTCAACCCTCATCCTCGTCGACAAAGGCAAC
GGCATCCTCGACGCCTTCTGGTTCTTCTTCTACTCGTACAACCTCGGCCAAACCGTGCTCGGCCTCCGGTTCGGA
AACCACGTCGGCGACTGGGAGCACTGCATGGTGCGCTTCCAGCATGGCGTTCCCCGCGGCATTTACCTCTCCGAG
CATGAGGGTGGGCAGGCTTATGCTTGGTCGGCCGTCGAGAAGAGGGGGGGGAGACCGGTTGTTTACTCGGCCTTG
GGTTCCCATGCCATGTACGCCCTCGCTGGGAATCACCCCTACGTCCTCCCCTTTTCGCTACTCAAGGACGTTACC
GATCGGGGACCGCGATGGGATCCAGCCTTGAACATGCGGGCCTATCACTACGATTACCTCCGTCCTCTAGACGGC
CTCTCCCCCGCGGCCACCAACCCGGATGCCCCGACAGGCTGGTTCCATTACCGCGGCCGCTGGGGCGACGCCGTC
TACGCCCTGGCCGATTCCCGCCAGTGGCGTCTCTTCGGGCAGTACCACTACGTTGCCGGACCGGCCGGACCCAAG
TTTAAGCACCTTGAACGGTCCAAGCTGTGCTCCGGCTCGCGGTGCAGGTTGTTGTACGAGTTGGATCCCGAGGGG
ACGTGGTACTGA
Gene >Ophcf2|02015
ATGGTGTCTTCGACTGGCGAAGGCGCGGAACCCGACGAAGCCGGCGCCCTGTCGGTTGAAGAACTGCTGCGGCAG
TTGGAGCACGATGATCAGGAGGAGTGGGAGTACGAGTATTCGGCTACGGAAACCGAGGTAGGTTGAAGCTGCGAC
CGTGACGGAAGCCGACCTTTACTGATTGCCGTCTCGCAAGACCTTTTACCTCACAATCGACCTATCGTACCCCGA
GTTCAAGGGACAGTCTACTCTGGTGCCGCCTCATCACCGGGGAGCCTACTACAAGGGCGAGACGGACCCGACGAC
CTGGGCGGACCCGGCGGTAGCAAAAGACTCGGGTCGGGCGGGCGGCGTGCTCAGCGATGACGAGGAAGATGCGGC
CAAAGACGACGAGAACGAGGACGAGAACGACGGTGACAACGAGGGCGAGGACCGTGTCATGATGGATGCGCCGGC
CGAAGGGGGTCGGAAGGATAAGGGGAAAGGAAAGGAGGTGCGGCCAAGAGAGAATGATGATGACGACCAGGACAA
GGATCAAGACATGGACGAGGATGCGCCGCTTGTTGATCCCGCGCTCAAGACGGTAGTTGTCGAGACGGAGAGTGG
CAGTCGAGCGGCAGACAAGGGGAAGCAAAAGGCACGAGACGAGGGAGCGGAACGCAGCTACGGAGACGAAAACCA
AGACGATGACAACCAGCAGCTCGAAGACATACAGATACTAGACCTGCACTCCCCGCGGCCTCTCTTCTCATACCG
AGGCCGCGTGTTTGAAGGACAATGGGCCGAAGTCATCGGCACAGAAGCCATCCTGACACACCACGACGACAAGGA
GGCACTGCCGGCACTCCGACAACTAGCAGAGGGAATCGACATGCTAGCGGCGAGCTCGTCGCGCATCGTTACAAC
GGAAAAGCTAGTCAGGCCCAAGGTAGCCCAAGTGGACACGCTGGCGCCGGTGCGCGAAGAGTGGAACATCCGGAT
CCCGGCGGGCAAGAGCCGGACACAGGAGAAGATGCAGCAGGTGCGCTTCCTCGAGAACCTGATGGCGCTGAAGAA
GAAGAAGGGGCAGGAAGATCAGGTGACGGTATTCGCCACGGACGGCGCGGGCAAAGACTGGAACGACAAGCACGC
TGTCGACTACAAGCCGCGATATAGAAAGCGGACGACGGCGATGGGGGCAGACGACGACGACGACGACGACGACGA
CGACACCGACGAAGAAGAGGTGGAGGACGAGGACCCGGATAGCAGGCGGAGGAGACGGCTGAGACAACAGCAGCG
GAGACGACGGCGACGGGCAGCGAGGGCGAGAGCCGCATCGGGAGTCGGAGGGACGAGTCGGGCTGGATAAAGAGA
CTGCGAGTCGGGCACGGGCCGAGCGTGTCGGATCGCGGAACGAAAAGCCAGAACAGAAGAAACAGCGTCATGACG
GGGAAACGACCTGTCAGCAGTAGCCAGCCAGCCGTCTTTACCTACCCAGATACCTTGGTTGGTTAGTTTAGTTTG
TTGCGTGGGCCAGAAGCTCAGTAGCTGGAAGCAAGGGGGGGGAGTGTCAAAGAAGAAGCTCATCAGTCGGGAGCC
AAAGAAAAGCCCAGACCCAGCCCCAGTCCCCAGTCCAGAACATGGAAGCCCCCCCCCCCAAACGACGGGCCCGTG
CTCAGCAGCGAGCAGCAAGCAGCGGCGACGGCGGCACTTCCCTCCCCATTCGCCCGCACGGCTGGCACCGATGAA
GCTGAAGAGGATGGATGCTAGGCGGTTGGTGAGACGGAAGGGAATGGGGAGGCGGGTCTACATATGTTTGGCTGG
GGTCGGGGATAATAGCCTTGGGTAGGTAGGTAGGTAGGCAGGTACCTAGTTGTGAGTTGTACATACATGTTCGTG
CCTTGGTTGGATTAGGTTGGGTCGGGTGTCTGTATGTATATGTGTATGTATGTATGTATGTATGTATGTATGTAC
TTTGTAGTGTAGCGACGTCAGCCTCGTTTCTTTTCGGGGCGGGATTTTGAAAATGAAATCTTTTCTTTGTTTCGC
TAGAGACGGGTGTGAGTTGGGTTGGTTGGGTTAAGAGGCATATGTAAGCTTGCCTTTCCTTCCGCCATCTTACCT
ACGAGAGAACCACCCCTTTATTTCCCCTTTCCCCCCCCCCCCCTTCTCCCTTTCCCACCCCTCCTTCTATTCCAA
TCTTTCCCCCCCCAACCTCCAGCCAACCCGCTTCCTCACTCGGAACCTTCCCGATGCCCCGTCCAGGGCAATAGC
AACGAGCCATGGGGCTGTTGCAGCGGTGGTTGCGCGGCGGCCTCGTGCTGGCGACGGTGTTGGCGTGCTTCTGCT
TCCTGGCCTGGTTCGTTCCGCGGGCGCTGAACCCGACGGAGACGAGTCCTGGGAGGCAGCTGGAGGATAAGCTTT
GGATCGAGACGAGTCCTTATTTCTGGGATCGCGTCGCGTGTCGGTGGTTGAGTCTTTGCGGGGTGCATCATTTAC
GTGCGGATCCGGCGGTGAGGCTCCAAGAGGATGATGATGATGACGATGTTGTTGTTGTTGGGGGGGAGTGGCTTG
AGTTGAGGAGGAGGGCTTTGGGGGGATGGGAGAGGGGAGGGAGAAGAGGAGGGGCAAGAGGAGGGTTGTTGAGCA
TGTGCCTGACTATGTTGTACGGTTTGCGCCCTACGTTCATCTTTACTCGGGGGAGCAGTTCTGGCCATCAGATAT
AGCCCATCACCTCCAGCACATGAAGGCGACAGATGACCACGGAAACCCTCTTCACCACGGCCTCGAAAACATCAA
CCTCGATGGACTCGACCATCTCGACGCGGGAGCCCACCACGTCAACCTCCACAGCTTGGACGACGTCGAGTCTCG
TCCAGATTGGCTATACAGTCGCCATGGCATCCCCAACCATGACGACGACGACGACGACGACGACGACGACGACGA
CGACAACGACAACAACAACGACAAGACGATAAATCCCGCCCCCCATCCACACCTCGAGAAAACAACCTGGTACGA
CGCAGACAGATCCCACCCCCCCATCGCCTCCACCCCCCATCCCCCTAACCCGCCGCTCCCCCCCCCAAGCCGGCC
ACAAGCCCAACTCGACCGGCCACTCGCAAGCGCCCTCAACCCTCATCCTCGTCGACAAAGGCAACGGCATCCTCG
ACGCCTTCTGGTTCTTCTTCTACTCGTACAACCTCGGCCAAACCGTGCTCGGCCTCCGGTTCGGAAACCACGTCG
GCGACTGGGAGCACTGCATGGTGCGCTTCCAGCATGGCGTTCCCCGCGGCATTTACCTCTCCGAGCATGAGGGTG
GGCAGGCTTATGCTTGGTCGGCCGTCGAGAAGAGGGGGGGGAGACCGGTTGTTTACTCGGCCTTGGGTTCCCATG
CCATGTACGCCCTCGCTGGGAATCACCCCTACGTCCTCCCCTTTTCGCTACTCAAGGACGTTACCGATCGGGGAC
CGCGATGGGATCCAGCCTTGAACATGCGGGCCTATCACTACGATTACCTCCGTCCTCTAGACGGCCTCTCCCCCG
CGGCCACCAACCCGGATGCCCCGACAGGCTGGTTCCATTACCGCGGCCGCTGGGGCGACGCCGTCTACGCCCTGG
CCGATTCCCGCCAGTGGCGTCTCTTCGGGCAGTACCACTACGTTGCCGGACCGGCCGGACCCAAGTTTAAGCACC
TTGAACGGTCCAAGCTGTGCTCCGGCTCGCGGTGCAGGTTGTTGTACGAGTTGGATCCCGAGGGGACGTGGTACT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail