Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02014
Gene name
Locationscaffold_02:2371130..2372865
Strand-
Gene length (bp)1735
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00977 His_biosynth Histidine biosynthesis protein 1.8E-44 241 527
PF00117 GATase Glutamine amidotransferase class-I 1.7E-20 9 199
PF07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain 3.4E-07 30 116

GO

GO Term Description Terminal node
GO:0000105 histidine biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0008652 cellular amino acid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0019752 carboxylic acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006547 histidine metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7417 0.4952 0.0241 0.1138 0.4431 0.0506 0.1169 0.309 0.2254 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3611
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1861
Ophiocordyceps australis map64 (Brazil) OphauB2|7336
Ophiocordyceps camponoti-floridani Ophcf2|02014 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4307
Ophiocordyceps kimflemingae Ophio5|3319
Ophiocordyceps subramaniannii Hirsu2|6967

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02014
MPSPPTVHLLDYVAGNIRSLVNAIEKLGYHVEWIKSPDDVPKADRLILPGVGHFGHCLSQLSQANYLSAINKHMA
DGKPFMGICVGLQALFQGSAEDPSVSGLGLIQASLGRFDDKAKSVPHIGWNSANVVGGVQMYDLGPSASTKYYYV
HSYNFPYEPGRLEEQGWTVATASYGSETFVGAVARGNIYATQFHPEKSGVAGLRTLRSFLTGRGAVSLGKPPVCP
LPSTTELTANDGLTRRVIACLDVRTNDQGDLVVTKGDQYDVRDESSSVRNLGKPVDLARRYYEAGADEITFLNIT
SFRDCPVADLPMLEVLRRASTCVFVPLTIGGGIRDTPDATALDVATLYFASGADKVSIGSDAVIAAEKYYARAAS
LDGSSSIELISRAYGVQAVVVSVDPRRVWLSSAEETTHHVVQTTETGPQGQSLCWYACTIKGGRETRDLDVVQLA
RAVQAMGAGELLLNSIDRDGSNSGFDLDLVRHVKAAVKIPVIASSGAGTPAHFEDVFNQTPTDAALGAGMFHRGE
YTVRQVKDYLREKGLLVRPFERHLDDAASTG*
Coding >Ophcf2|02014
ATGCCGTCTCCGCCCACCGTCCATCTCCTCGACTACGTCGCCGGTAACATCAGGAGCCTGGTCAACGCGATTGAA
AAGCTCGGCTACCACGTCGAGTGGATCAAGTCGCCCGACGATGTGCCCAAAGCCGACAGACTCATCCTCCCCGGC
GTAGGCCACTTCGGCCACTGCCTCTCCCAGCTCTCGCAAGCAAACTACCTAAGCGCCATCAACAAGCACATGGCA
GACGGGAAGCCCTTCATGGGCATCTGCGTCGGTCTACAGGCTCTCTTCCAGGGCTCAGCCGAGGACCCTTCCGTC
TCCGGACTGGGACTCATCCAGGCTTCGCTCGGCCGCTTCGACGACAAGGCCAAGTCTGTGCCGCATATCGGGTGG
AACAGCGCCAATGTCGTGGGCGGCGTCCAGATGTACGACCTCGGACCCTCGGCCTCAACCAAATACTACTACGTC
CATTCCTACAACTTCCCCTACGAACCCGGTCGGCTCGAGGAACAAGGCTGGACGGTAGCGACGGCTTCCTACGGC
TCCGAGACCTTTGTAGGCGCCGTGGCACGAGGCAACATCTACGCGACGCAGTTCCACCCCGAGAAGTCGGGCGTC
GCCGGTCTCCGTACCCTCCGATCCTTTCTCACCGGCCGCGGCGCCGTCTCTCTCGGCAAACCCCCCGTCTGCCCC
CTCCCGTCCACGACGGAACTCACGGCCAACGACGGCCTCACCCGCCGCGTAATCGCCTGTCTCGACGTCCGAACA
AACGACCAAGGCGACCTCGTCGTCACAAAAGGCGACCAATACGACGTCCGCGACGAGTCCTCTTCCGTCCGTAAC
CTCGGCAAACCAGTCGACCTCGCCCGTCGCTACTACGAAGCCGGCGCCGATGAAATCACCTTTCTCAACATCACC
TCGTTCCGCGACTGTCCCGTCGCCGACCTCCCCATGCTGGAAGTCCTTCGTCGCGCCTCAACCTGCGTCTTCGTC
CCCCTCACCATCGGAGGCGGCATCCGCGACACCCCCGACGCGACAGCCCTCGACGTCGCGACCCTCTACTTCGCC
TCGGGCGCCGACAAGGTCTCCATCGGCTCCGACGCCGTCATCGCCGCCGAAAAGTACTACGCCCGCGCCGCCAGC
CTGGACGGCTCCTCCTCCATCGAACTCATCTCCCGCGCCTACGGCGTCCAAGCCGTCGTCGTCAGCGTCGACCCC
CGGCGCGTATGGCTGTCCTCGGCCGAAGAAACCACCCACCACGTCGTCCAGACCACCGAGACCGGCCCCCAAGGC
CAATCCCTCTGCTGGTACGCCTGCACCATCAAGGGCGGCCGCGAGACGCGCGACCTCGACGTCGTCCAGCTCGCG
CGAGCCGTCCAGGCAATGGGCGCGGGCGAGCTCCTCCTCAACTCCATCGATCGCGACGGCTCCAATTCGGGCTTC
GACCTCGACCTCGTCCGTCACGTCAAGGCCGCCGTCAAGATCCCCGTCATCGCCTCCAGCGGCGCCGGAACTCCC
GCTCACTTTGAGGACGTCTTCAACCAGACTCCCACAGACGCCGCTCTCGGCGCCGGCATGTTCCACCGCGGGGAA
TACACCGTCAGGCAGGTCAAGGATTACCTGCGAGAAAAGGGGCTCCTGGTCAGGCCCTTTGAACGTCATCTGGAC
GATGCAGCGTCGACAGGCTAG
Transcript >Ophcf2|02014
ATGCCGTCTCCGCCCACCGTCCATCTCCTCGACTACGTCGCCGGTAACATCAGGAGCCTGGTCAACGCGATTGAA
AAGCTCGGCTACCACGTCGAGTGGATCAAGTCGCCCGACGATGTGCCCAAAGCCGACAGACTCATCCTCCCCGGC
GTAGGCCACTTCGGCCACTGCCTCTCCCAGCTCTCGCAAGCAAACTACCTAAGCGCCATCAACAAGCACATGGCA
GACGGGAAGCCCTTCATGGGCATCTGCGTCGGTCTACAGGCTCTCTTCCAGGGCTCAGCCGAGGACCCTTCCGTC
TCCGGACTGGGACTCATCCAGGCTTCGCTCGGCCGCTTCGACGACAAGGCCAAGTCTGTGCCGCATATCGGGTGG
AACAGCGCCAATGTCGTGGGCGGCGTCCAGATGTACGACCTCGGACCCTCGGCCTCAACCAAATACTACTACGTC
CATTCCTACAACTTCCCCTACGAACCCGGTCGGCTCGAGGAACAAGGCTGGACGGTAGCGACGGCTTCCTACGGC
TCCGAGACCTTTGTAGGCGCCGTGGCACGAGGCAACATCTACGCGACGCAGTTCCACCCCGAGAAGTCGGGCGTC
GCCGGTCTCCGTACCCTCCGATCCTTTCTCACCGGCCGCGGCGCCGTCTCTCTCGGCAAACCCCCCGTCTGCCCC
CTCCCGTCCACGACGGAACTCACGGCCAACGACGGCCTCACCCGCCGCGTAATCGCCTGTCTCGACGTCCGAACA
AACGACCAAGGCGACCTCGTCGTCACAAAAGGCGACCAATACGACGTCCGCGACGAGTCCTCTTCCGTCCGTAAC
CTCGGCAAACCAGTCGACCTCGCCCGTCGCTACTACGAAGCCGGCGCCGATGAAATCACCTTTCTCAACATCACC
TCGTTCCGCGACTGTCCCGTCGCCGACCTCCCCATGCTGGAAGTCCTTCGTCGCGCCTCAACCTGCGTCTTCGTC
CCCCTCACCATCGGAGGCGGCATCCGCGACACCCCCGACGCGACAGCCCTCGACGTCGCGACCCTCTACTTCGCC
TCGGGCGCCGACAAGGTCTCCATCGGCTCCGACGCCGTCATCGCCGCCGAAAAGTACTACGCCCGCGCCGCCAGC
CTGGACGGCTCCTCCTCCATCGAACTCATCTCCCGCGCCTACGGCGTCCAAGCCGTCGTCGTCAGCGTCGACCCC
CGGCGCGTATGGCTGTCCTCGGCCGAAGAAACCACCCACCACGTCGTCCAGACCACCGAGACCGGCCCCCAAGGC
CAATCCCTCTGCTGGTACGCCTGCACCATCAAGGGCGGCCGCGAGACGCGCGACCTCGACGTCGTCCAGCTCGCG
CGAGCCGTCCAGGCAATGGGCGCGGGCGAGCTCCTCCTCAACTCCATCGATCGCGACGGCTCCAATTCGGGCTTC
GACCTCGACCTCGTCCGTCACGTCAAGGCCGCCGTCAAGATCCCCGTCATCGCCTCCAGCGGCGCCGGAACTCCC
GCTCACTTTGAGGACGTCTTCAACCAGACTCCCACAGACGCCGCTCTCGGCGCCGGCATGTTCCACCGCGGGGAA
TACACCGTCAGGCAGGTCAAGGATTACCTGCGAGAAAAGGGGCTCCTGGTCAGGCCCTTTGAACGTCATCTGGAC
GATGCAGCGTCGACAGGCTAG
Gene >Ophcf2|02014
ATGCCGTCTCCGCCCACCGTCCATCTCCTCGACTACGTCGCCGGTAACATCAGGAGCCTGGTCAACGCGATTGAA
AAGCTCGGCTACCACGTCGAGTGGATCAAGTCGCCCGACGATGTGCCCAAAGCCGACGTTCGTCTTCACCTTCCC
CCTCCCCATATCATCCAACACCATCGTCTCTAAACCCGCGAGACAGAGACTCATCCTCCCCGGCGTAGGCCACTT
CGGCCACTGCCTCTCCCAGCTCTCGCAAGCAAACTACCTAAGCGCCATCAACAAGCACATGGCAGACGGGAAGCC
CTTCATGGGCATCTGCGTCGGTCTACAGGCTCTCTTCCAGGGCTCAGCCGAGGACCCTTCCGTCTCCGGACTGGG
ACTCATCCAGGCTTCGCTCGGCCGCTTCGACGACAAGGCCAAGTCTGTGCCGCATATCGGGTGGAACAGCGCCAA
TGTCGTGGGCGGCGTCCAGATGTACGACCTCGGACCCTCGGCCTCAACCAAATACTACTACGTCCATTCCTACAA
CTTCCCCTACGAACCCGGTCGGCTCGAGGAACAAGGCTGGACGGTAGCGACGGCTTCCTACGGCTCCGAGACCTT
TGTAGGCGCCGTGGCACGAGGCAACATCTACGCGACGCAGTTCCACCCCGAGAAGTCGGGCGTCGCCGGTCTCCG
TACCCTCCGATCCTTTCTCACCGGCCGCGGCGCCGTCTCTCTCGGCAAACCCCCCGTCTGCCCCCTCCCGTCCAC
GACGGAACTCACGGCCAACGACGGCCTCACCCGCCGCGTAATCGCCTGTCTCGACGTCCGAACAAACGACCAAGG
CGACCTCGTCGTCACAAAAGGCGACCAATACGACGTCCGCGACGAGTCCTCTTCCGTCCGTAACCTCGGCAAACC
AGTCGACCTCGCCCGTCGCTACTACGAAGCCGGCGCCGATGAAATCACCTTTCTCAACATCACCTCGTTCCGCGA
CTGTCCCGTCGCCGACCTCCCCATGCTGGAAGTCCTTCGTCGCGCCTCAACCTGCGTCTTCGTCCCCCTCACCAT
CGGAGGCGGCATCCGCGACACCCCCGACGCGACAGCCCTCGACGTCGCGACCCTCTACTTCGCCTCGGGCGCCGA
CAAGGTCTCCATCGGCTCCGACGCCGTCATCGCCGCCGAAAAGTACTACGCCCGCGCCGCCAGCCTGGACGGCTC
CTCCTCCATCGAACTCATCTCCCGCGCCTACGGCGTCCAAGCCGTCGTCGTCAGCGTCGACCCCCGGCGCGTATG
GCTGTCCTCGGCCGAAGAAACCACCCACCACGTCGTCCAGACCACCGAGACCGGCCCCCAAGGCCAATCCCTCTG
CTGGTACGCCTGCACCATCAAGGGCGGCCGCGAGACGCGCGACCTCGACGTCGTCCAGCTCGCGCGAGCCGTCCA
GGCAATGGGCGCGGGCGAGCTCCTCCTCAACTCCATCGATCGCGACGGCTCCAATTCGGGCTTCGACCTCGACCT
CGTCCGTCACGTCAAGGCCGCCGTCAAGATCCCCGTCATCGCCTCCAGCGGCGCCGGAACTCCCGCTCACTTTGA
GGACGTCTTCAACCAGACTCCCACAGACGCCGCTCTCGGCGCCGGCATGTTCCACCGCGGGGAATACACCGTCAG
GCAGGTCAAGGATTACCTGCGAGAAAAGGGGCTCCTGGTCAGGCCCTTTGAACGTCATCTGGACGATGCAGCGTC
GACAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail