Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02007
Gene name
Locationscaffold_02:2354447..2356919
Strand+
Gene length (bp)2472
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 4.5E-38 17 202
PF00958 GMP_synt_C GMP synthase C terminal domain 4.8E-32 450 539
PF02540 NAD_synthase NAD synthase 7.2E-06 232 311
PF07722 Peptidase_C26 Peptidase C26 7.4E-05 84 185

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0006164 purine nucleotide biosynthetic process Yes
GO:0003922 GMP synthase (glutamine-hydrolyzing) activity Yes
GO:0006177 GMP biosynthetic process Yes
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0097159 organic cyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044249 cellular biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0046037 GMP metabolic process No
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor No
GO:0006163 purine nucleotide metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0046390 ribose phosphate biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0032553 ribonucleotide binding No
GO:0090407 organophosphate biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0071704 organic substance metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0043167 ion binding No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0016874 ligase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7599 0.5835 0.0245 0.1743 0.2215 0.0126 0.1034 0.063 0.1376 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2275
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5988
Ophiocordyceps australis map64 (Brazil) OphauB2|2038
Ophiocordyceps camponoti-floridani Ophcf2|02007 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2944
Ophiocordyceps kimflemingae Ophio5|1387
Ophiocordyceps subramaniannii Hirsu2|2997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02007
MAAQAKALHEKFDTILVLDFGSQYTHLITRRLRELHVLAELLPCTTKLAELDFKPKGIILSGGPYSVYQEDAPQV
DPAIFELPDTPILGICYGLQLLAWRLSRDNVVAGTQREYGQADVVARRHGGPVDRLFQDVGDAMQVYMSHGDRLS
QLPDGFCTIATTDNSPFAGIAHIEKPIFGIQFHPEVTHTPRGKDLLRNFAVNICRAEQNWSMSSFCDQEIARLRK
LIGPTAQVIGAVSGGVDSTVGAKLLKEAIGSRFHAVLVDNGVMRLNECQQVKETLAEHLGIALTVVDASQRFLEA
LEGVVDSEQKRKRIGNLFIDIFEEEAIRIEKEAENTPNAGKVEWFLQGTLYPDVIESISFKGPSATIKTHHNVGG
LPQRMIDGQGLKLIEPLRELFKDEVRELGRQLGVHEDLVMRHPFPGPGIAIRIIGQVTPERVRIARQADHIYISM
IRQAGLYNQISQAYAGLDTNKAVGVMGDKRYEGFIIILRAVVTTDFMTAEPFPFSMQFLSEVSRRIVNEVDGVSL
VTYNVTSKPPSTIELQ*
Coding >Ophcf2|02007
ATGGCGGCGCAGGCAAAGGCACTTCACGAAAAGTTCGACACGATTCTCGTGCTCGACTTTGGATCGCAATATACA
CATCTCATCACCCGTCGGCTAAGAGAGCTTCACGTCTTGGCCGAACTCCTCCCCTGCACCACCAAATTAGCCGAG
CTTGACTTTAAGCCCAAGGGCATCATTCTCTCGGGCGGCCCTTACTCCGTTTACCAAGAGGACGCTCCGCAGGTC
GACCCTGCCATCTTTGAACTACCAGACACCCCTATCCTCGGAATCTGTTACGGCTTGCAGCTGCTGGCCTGGAGA
CTCTCTCGGGATAATGTCGTCGCAGGCACCCAGCGCGAGTATGGGCAAGCGGACGTCGTGGCACGGCGCCATGGC
GGCCCTGTCGACCGCCTGTTCCAAGACGTGGGAGACGCCATGCAAGTCTACATGTCTCACGGCGATCGCCTAAGT
CAACTCCCCGACGGCTTCTGCACAATCGCCACAACAGACAACTCACCTTTCGCCGGCATCGCCCACATAGAAAAG
CCCATCTTTGGCATTCAATTTCATCCAGAGGTGACGCACACGCCCAGGGGCAAGGACTTGCTACGCAACTTTGCC
GTCAACATCTGCCGAGCCGAGCAAAACTGGTCCATGTCGAGCTTCTGCGACCAAGAGATTGCCCGGCTTCGGAAG
CTGATAGGGCCCACGGCCCAGGTCATCGGTGCCGTCTCCGGAGGCGTCGATTCCACCGTCGGAGCGAAACTGCTC
AAGGAAGCCATCGGGTCGCGGTTCCATGCCGTGCTCGTTGATAACGGCGTGATGCGTCTCAACGAGTGTCAGCAG
GTCAAGGAGACGCTGGCCGAGCACCTAGGTATCGCTCTCACCGTGGTCGATGCGTCGCAGCGCTTCCTTGAGGCG
CTTGAGGGGGTGGTGGACTCGGAGCAGAAGAGGAAACGGATCGGCAACCTGTTTATCGACATTTTCGAAGAGGAG
GCTATCCGAATTGAAAAGGAGGCCGAGAACACGCCTAATGCCGGCAAAGTGGAATGGTTCCTCCAAGGCACGCTG
TATCCCGACGTAATCGAGAGCATCTCATTCAAAGGTCCTTCTGCAACCATCAAGACTCACCACAACGTGGGGGGG
CTACCCCAAAGGATGATTGATGGCCAGGGTCTCAAGCTCATCGAGCCGTTGCGTGAGCTCTTCAAGGACGAGGTT
CGGGAACTCGGCCGACAGCTCGGTGTACACGAAGACCTCGTGATGCGACATCCGTTCCCGGGCCCAGGCATCGCG
ATCCGTATCATCGGCCAAGTCACGCCCGAGAGAGTCCGAATCGCGAGACAAGCGGATCACATCTACATAAGCATG
ATCAGGCAAGCCGGCCTCTACAACCAGATCAGCCAAGCCTACGCCGGTCTCGACACGAACAAAGCTGTAGGCGTC
ATGGGCGACAAGCGCTACGAGGGGTTCATCATCATCCTCCGCGCCGTCGTCACCACCGACTTCATGACGGCCGAG
CCGTTCCCATTCAGCATGCAGTTCCTGAGCGAGGTATCGCGCCGCATCGTCAACGAGGTCGATGGCGTCAGTCTG
GTGACGTACAATGTGACGAGCAAGCCGCCGAGCACCATCGAGCTGCAGTGA
Transcript >Ophcf2|02007
ATGGCGGCGCAGGCAAAGGCACTTCACGAAAAGTTCGACACGATTCTCGTGCTCGACTTTGGATCGCAATATACA
CATCTCATCACCCGTCGGCTAAGAGAGCTTCACGTCTTGGCCGAACTCCTCCCCTGCACCACCAAATTAGCCGAG
CTTGACTTTAAGCCCAAGGGCATCATTCTCTCGGGCGGCCCTTACTCCGTTTACCAAGAGGACGCTCCGCAGGTC
GACCCTGCCATCTTTGAACTACCAGACACCCCTATCCTCGGAATCTGTTACGGCTTGCAGCTGCTGGCCTGGAGA
CTCTCTCGGGATAATGTCGTCGCAGGCACCCAGCGCGAGTATGGGCAAGCGGACGTCGTGGCACGGCGCCATGGC
GGCCCTGTCGACCGCCTGTTCCAAGACGTGGGAGACGCCATGCAAGTCTACATGTCTCACGGCGATCGCCTAAGT
CAACTCCCCGACGGCTTCTGCACAATCGCCACAACAGACAACTCACCTTTCGCCGGCATCGCCCACATAGAAAAG
CCCATCTTTGGCATTCAATTTCATCCAGAGGTGACGCACACGCCCAGGGGCAAGGACTTGCTACGCAACTTTGCC
GTCAACATCTGCCGAGCCGAGCAAAACTGGTCCATGTCGAGCTTCTGCGACCAAGAGATTGCCCGGCTTCGGAAG
CTGATAGGGCCCACGGCCCAGGTCATCGGTGCCGTCTCCGGAGGCGTCGATTCCACCGTCGGAGCGAAACTGCTC
AAGGAAGCCATCGGGTCGCGGTTCCATGCCGTGCTCGTTGATAACGGCGTGATGCGTCTCAACGAGTGTCAGCAG
GTCAAGGAGACGCTGGCCGAGCACCTAGGTATCGCTCTCACCGTGGTCGATGCGTCGCAGCGCTTCCTTGAGGCG
CTTGAGGGGGTGGTGGACTCGGAGCAGAAGAGGAAACGGATCGGCAACCTGTTTATCGACATTTTCGAAGAGGAG
GCTATCCGAATTGAAAAGGAGGCCGAGAACACGCCTAATGCCGGCAAAGTGGAATGGTTCCTCCAAGGCACGCTG
TATCCCGACGTAATCGAGAGCATCTCATTCAAAGGTCCTTCTGCAACCATCAAGACTCACCACAACGTGGGGGGG
CTACCCCAAAGGATGATTGATGGCCAGGGTCTCAAGCTCATCGAGCCGTTGCGTGAGCTCTTCAAGGACGAGGTT
CGGGAACTCGGCCGACAGCTCGGTGTACACGAAGACCTCGTGATGCGACATCCGTTCCCGGGCCCAGGCATCGCG
ATCCGTATCATCGGCCAAGTCACGCCCGAGAGAGTCCGAATCGCGAGACAAGCGGATCACATCTACATAAGCATG
ATCAGGCAAGCCGGCCTCTACAACCAGATCAGCCAAGCCTACGCCGGTCTCGACACGAACAAAGCTGTAGGCGTC
ATGGGCGACAAGCGCTACGAGGGGTTCATCATCATCCTCCGCGCCGTCGTCACCACCGACTTCATGACGGCCGAG
CCGTTCCCATTCAGCATGCAGTTCCTGAGCGAGGTATCGCGCCGCATCGTCAACGAGGTCGATGGCGTCAGTCTG
GTGACGTACAATGTGACGAGCAAGCCGCCGAGCACCATCGAGCTGCAGTGA
Gene >Ophcf2|02007
ATGGCGGCGCAGGCAAAGGCACTTCACGAAAAGTTCGACGTCAGCCTCGCTTGCCTCGCTTTAGGGTCGTTCTGC
TGCTGACTCAATGCCGCAGACGATTCTCGTGCTCGACTTTGGATCGCAAGTATGGACAAGACGTTATTTTTCTTC
TGCTCTGTATTGAAACTAATCACCATATCCAGTATACACATCTCATCACCCGTCGGCTAAGAGAGGTAGGTTTTG
TCACCAACGTCAGGGCCTCTGTGAGGCGCTGACAGAGACCGCAGCTTCACGTCTTGGCCGAACTCCTCCCCTGCA
CCACCAAATTAGCCGAGCTTGACTTTAAGCCCAAGGGCATCATTCTCTCGGGCGGTGAGAGTTGCCTCAGAGAAT
TTACCCAGCACACGCAACTGACGCTCTGAGCCAGGCCCTTACTCCGTTTACCAAGAGGACGCTCCGCGTACGTGC
CTGATGGGCTACGCTCGTCATCACAGTACTTACTTTCCTTAGAGGTCGACCCTGCCATCTTTGAACTACCAGACA
CCCCTATCCTCGGAATCTGTTACGGCTTGCAGCTGCTGGCCTGGAGACTCTCTCGGGATAATGTCGTCGCAGGCA
CCCAGGTAGATCAAGTGTCGACTTCGTGTCTGTCAACCCCCGCTAACCAAGGTCCAGCGCGAGTATGGGCAAGCG
GACGTCGTGGCACGGCGCCATGGCGGCCCTGTCGACCGCCTGTTCCAAGACGTGGGAGACGCCATGCAAGTCGTG
AGTGATGTCATGCAATTCTTTTGGCCCAACGATGTTGACGGGACCAGTACATGTCTCACGGCGATCGCCTAAGTC
AACTCCCCGACGGCTTCTGCACAATCGCCACAACAGACAACTCACCTTTCGCCGGCATCGCCCACATAGAAAAGC
CCATCTTTGGCATTCAATTTCATCCAGAGGTGACGCACACGCCCAGGGGCAAGGACTTGCTACGCAACTTTGCCG
TCAACATCTGCCGAGGTGAGCCTGCTGTTCCGGTCTATTCTATCTGCCTGAGTGATCGGGTTCTCACCTTTCAGC
CGAGCAAAACTGGTCCATGTCGAGCTTCTGCGACCAAGAGATTGCCCGGCTTCGGAAGCTGATAGGGCCCACGGC
CCAGGTCATCGGTGCCGTCTCCGTACGTCTCGGCCTCTTGGGTGTGCTGTCGTAGGACGTGGCTCACTGTTGCAG
GGAGGCGTCGATTCCACCGTCGGAGCGAAACTGCTCAAGGAAGCCATCGGGTCGCGGTTCCATGCCGTGGTAGGT
TGTCGTCCGTTCGACATCTGTCAAGCCCAGCTCACGCGTTTCTAGCTCGTTGATAACGGCGTGATGCGTCTCAAC
GAGTGTCAGCAGGTCAAGGAGACGCTGGCCGAGCACCTAGGTATCGCTCTCACCGTGGTCGATGCGTCGCAGCGC
TTCCTTGAGGCGCTTGAGGGGGTGGTGGACTCGGAGCAGAAGAGGAAACGGATCGGCAACCTGTTTATCGACATT
TTCGAAGAGGAGGCTATCCGAATTGAAAAGGAGGCCGAGAACACGCCTAATGCCGGCAAAGTGGAATGGGTAAGC
ACGTCACGCTCTGGGGCAAGAAGGGTGATACTAAATGTCTGCAGTTCCTCCAAGGCACGCTGTGTATGTGTCGTC
GACTTTTCTTTACGCGTTGCTGCAACTATTGTGCTGACTATGGCGTGAAGATCCCGACGTAATCGAGAGCATCTC
ATTCAAAGGTCCTTCTGCAACCATCAAGGTGAGTTTCTGACGAGAGTCGAACTACAGCATTCGATAAGCACTACA
AGGAAGCAGGATGGAGTGGGCTAACCTTTCAGACTCACCACAACGTGGGGGGGCTACCCCAAAGGATGATTGATG
GCCAGGGTCTCAAGCTCATCGAGCCGTTGCGTGAGCTCTTCAAGGACGAGGTTCGGGAACTCGGCCGACAGCTCG
GTGTACACGAAGACCTCGTGATGCGGTATGACGCATCCCCGTCGAAAAACGTCGAAGCACGCCTAACTCGTCCCA
GACATCCGTTCCCGGGCCCAGGCATCGCGATCCGTATCATCGGCCAAGTCACGCCCGAGAGAGTCCGAATCGCGA
GACAAGCGGATCACATCTACATAAGCATGATCAGGCAAGCCGGCCTCTACAACCAGATCAGCCAAGCCTACGCCG
GTCTCGACACGAACAAAGCTGTAGGCGTCATGGGCGACAAGCGCTACGAGGGGTTCATCATCATCCTCCGCGCCG
TCGTCACCACCGACTTCATGACGGCCGAGGTGATTCGCCCGTTTTATTCTTCGTGTGTGTGGTCTTCGTGCGTGG
CGAGTGCTAATGTTTGTTTAGCCGTTCCCATTCAGCATGCAGTTCCTGAGCGAGGTATCGCGCCGCATCGTCAAC
GAGGTCGATGGCGTCAGTCTGGTGACGTACAATGTGACGAGCAAGCCGCCGAGCACCATCGAGCTGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail