Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02005
Gene name
Locationscaffold_02:2349729..2350809
Strand-
Gene length (bp)1080
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 6.6E-17 138 313

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1576 0.1708 0.1706 0.1208 0.0789 0.0056 0.4893 0.2484 0.8919 0.0194

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT34 1.1E-33 137 317

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2614
Ophiocordyceps australis map64 (Brazil) OphauB2|6821
Ophiocordyceps camponoti-floridani Ophcf2|02005 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2947
Ophiocordyceps kimflemingae Ophio5|1385
Ophiocordyceps subramaniannii Hirsu2|2730

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02005
MNFTLVKIGAGIVTVVFLLWQLSSHLNYSYSIHSVLEQYRVSRHNTATGGLGVHGSQNCVSDIDTVAVGREAAAF
RRSCLASHPARALLGQESPRVATVSVHFTEPGKDTYYQNAIRTHLLHRLVHESHLSLLCSPLVNGMWNKQAYLLS
VMLEEMAKPADERLQWIFWADRDSIVVDPCRDVTDFLPQSALEEDSVSDKHQINLLIAKDWNGINAGIFLLRVGE
WGIDFLNDVLSFPRFKPNVTLTFEEQSAMDVLLQEEKYEYGVRYVPQHWFNAYPNEGGRMEQYTAMNNTDELNEW
AVRRGDFVVHFAGFPNKEEEINGYIKAMKKEGNVWESGRALRDVSGEVDEFWSNSSHVS*
Coding >Ophcf2|02005
ATGAATTTCACTCTGGTCAAGATCGGCGCGGGAATCGTCACCGTCGTCTTTCTCTTATGGCAACTATCTTCCCAC
TTGAACTACTCCTACTCTATTCACTCGGTCCTCGAGCAATACCGCGTCAGCAGACACAACACAGCAACAGGCGGA
CTCGGAGTCCACGGAAGTCAGAACTGCGTTTCCGATATAGACACCGTCGCCGTCGGCCGAGAAGCCGCCGCCTTC
CGCCGTTCTTGTCTGGCTTCTCATCCGGCTCGGGCCTTGTTAGGACAGGAGAGTCCCAGAGTGGCGACGGTCTCG
GTTCACTTTACGGAGCCCGGAAAGGACACTTACTACCAGAATGCCATCCGCACTCACCTCCTGCACCGGCTCGTC
CACGAATCACACCTGAGCTTGCTCTGCTCGCCCCTCGTCAACGGCATGTGGAACAAGCAGGCTTATCTACTCAGT
GTGATGCTGGAGGAGATGGCCAAACCGGCTGACGAGAGGCTGCAATGGATCTTCTGGGCTGATCGCGATAGCATC
GTCGTCGATCCTTGTCGAGACGTGACCGATTTCCTGCCGCAGTCAGCTCTCGAGGAGGACTCTGTGTCGGACAAG
CATCAGATAAACCTGTTGATAGCAAAGGACTGGAATGGCATAAACGCCGGCATCTTCCTCCTCCGCGTGGGAGAA
TGGGGCATCGATTTCCTCAACGACGTCCTATCGTTCCCACGCTTTAAGCCCAACGTCACGCTCACATTCGAGGAA
CAGTCGGCCATGGATGTTCTTCTCCAGGAAGAGAAATACGAGTATGGCGTCCGCTATGTTCCGCAGCACTGGTTC
AACGCCTACCCCAACGAGGGCGGTCGGATGGAGCAGTACACTGCTATGAATAACACGGATGAGCTGAATGAATGG
GCTGTCCGTCGCGGAGACTTTGTCGTTCACTTTGCCGGTTTCCCGAACAAGGAGGAGGAAATTAACGGATATATC
AAGGCGATGAAGAAGGAGGGTAATGTGTGGGAGTCGGGTCGAGCTTTGAGGGATGTTAGTGGTGAGGTTGACGAG
TTCTGGTCCAACAGCTCCCATGTGTCTTGA
Transcript >Ophcf2|02005
ATGAATTTCACTCTGGTCAAGATCGGCGCGGGAATCGTCACCGTCGTCTTTCTCTTATGGCAACTATCTTCCCAC
TTGAACTACTCCTACTCTATTCACTCGGTCCTCGAGCAATACCGCGTCAGCAGACACAACACAGCAACAGGCGGA
CTCGGAGTCCACGGAAGTCAGAACTGCGTTTCCGATATAGACACCGTCGCCGTCGGCCGAGAAGCCGCCGCCTTC
CGCCGTTCTTGTCTGGCTTCTCATCCGGCTCGGGCCTTGTTAGGACAGGAGAGTCCCAGAGTGGCGACGGTCTCG
GTTCACTTTACGGAGCCCGGAAAGGACACTTACTACCAGAATGCCATCCGCACTCACCTCCTGCACCGGCTCGTC
CACGAATCACACCTGAGCTTGCTCTGCTCGCCCCTCGTCAACGGCATGTGGAACAAGCAGGCTTATCTACTCAGT
GTGATGCTGGAGGAGATGGCCAAACCGGCTGACGAGAGGCTGCAATGGATCTTCTGGGCTGATCGCGATAGCATC
GTCGTCGATCCTTGTCGAGACGTGACCGATTTCCTGCCGCAGTCAGCTCTCGAGGAGGACTCTGTGTCGGACAAG
CATCAGATAAACCTGTTGATAGCAAAGGACTGGAATGGCATAAACGCCGGCATCTTCCTCCTCCGCGTGGGAGAA
TGGGGCATCGATTTCCTCAACGACGTCCTATCGTTCCCACGCTTTAAGCCCAACGTCACGCTCACATTCGAGGAA
CAGTCGGCCATGGATGTTCTTCTCCAGGAAGAGAAATACGAGTATGGCGTCCGCTATGTTCCGCAGCACTGGTTC
AACGCCTACCCCAACGAGGGCGGTCGGATGGAGCAGTACACTGCTATGAATAACACGGATGAGCTGAATGAATGG
GCTGTCCGTCGCGGAGACTTTGTCGTTCACTTTGCCGGTTTCCCGAACAAGGAGGAGGAAATTAACGGATATATC
AAGGCGATGAAGAAGGAGGGTAATGTGTGGGAGTCGGGTCGAGCTTTGAGGGATGTTAGTGGTGAGGTTGACGAG
TTCTGGTCCAACAGCTCCCATGTGTCTTGA
Gene >Ophcf2|02005
ATGAATTTCACTCTGGTCAAGATCGGCGCGGGAATCGTCACCGTCGTCTTTCTCTTATGGCAACTATCTTCCCAC
TTGAACTACTCCTACTCTATTCACTCGGTCCTCGAGCAATACCGCGTCAGCAGACACAACACAGCAACAGGCGGA
CTCGGAGTCCACGGAAGTCAGAACTGCGTTTCCGATATAGACACCGTCGCCGTCGGCCGAGAAGCCGCCGCCTTC
CGCCGTTCTTGTCTGGCTTCTCATCCGGCTCGGGCCTTGTTAGGACAGGAGAGTCCCAGAGTGGCGACGGTCTCG
GTTCACTTTACGGAGCCCGGAAAGGACACTTACTACCAGAATGCCATCCGCACTCACCTCCTGCACCGGCTCGTC
CACGAATCACACCTGAGCTTGCTCTGCTCGCCCCTCGTCAACGGCATGTGGAACAAGCAGGCTTATCTACTCAGT
GTGATGCTGGAGGAGATGGCCAAACCGGCTGACGAGAGGCTGCAATGGATCTTCTGGGCTGATCGCGATAGCATC
GTCGTCGATCCTTGTCGAGACGTGACCGATTTCCTGCCGCAGTCAGCTCTCGAGGAGGACTCTGTGTCGGACAAG
CATCAGATAAACCTGTTGATAGCAAAGGACTGGAATGGCATAAACGCCGGCATCTTCCTCCTCCGCGTGGGAGAA
TGGGGCATCGATTTCCTCAACGACGTCCTATCGTTCCCACGCTTTAAGCCCAACGTCACGCTCACATTCGAGGAA
CAGTCGGCCATGGATGTTCTTCTCCAGGAAGAGAAATACGAGTATGGCGTCCGCTATGTTCCGCAGCACTGGTTC
AACGCCTACCCCAACGAGGGCGGTCGGATGGAGCAGTACACTGCTATGAATAACACGGATGAGCTGAATGAATGG
GCTGTCCGTCGCGGAGACTTTGTCGTTCACTTTGCCGGTTTCCCGAACAAGGAGGAGGAAATTAACGGATATATC
AAGGCGATGAAGAAGGAGGGTAATGTGTGGGAGTCGGGTCGAGCTTTGAGGGATGTTAGTGGTGAGGTTGACGAG
TTCTGGTCCAACAGCTCCCATGTGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail