Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02000
Gene name
Locationscaffold_02:2334203..2337444
Strand-
Gene length (bp)3241
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin 4.2E-58 441 588
PF01266 DAO FAD dependent oxidoreductase 6.6E-42 44 308
PF00890 FAD_binding_2 FAD binding domain 6.0E-06 44 249

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6504 0.4372 0.0846 0.0391 0.3919 0.0882 0.073 0.0801 0.0707 0.2092

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4512
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|7328
Ophiocordyceps camponoti-floridani Ophcf2|02000 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|919
Ophiocordyceps kimflemingae Ophio5|1378
Ophiocordyceps subramaniannii Hirsu2|9427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02000
MTTADRDTRASLPSKESTSSFWHSEPSQRLLGHRSTELVPTEADIVVIGSGISGTFVAKGLVEGGRRVVMLEARE
ACWGATGRNGGHCQPGVWNSSPSVARFELATLHMLAGLVAEQGIACDWQLVGGVHGLWSTAELEAARKQMRRLAR
HAHLRDSVRLVTDRDELRALRLAEGAIGAVVQRQAAVLWPYKLVAAVLEALLDRGMNLQTGTAVVGLKREETGGG
WMVETERGVIAARHVVLATNGYTSYLLPSMTDLIVPVQGQVCALKPPTGSRPLEHSYSWLPTASDDYLLQRPSGG
LLILGGERCSVQGGRMGISRDDVVDGVIGGRLRRAMRSAVKLRGRGEEEEAELVAAMECSLSEVSPRQLTSALFQ
ALRLLTFPETDDSGLAWPLASHLTSRHGDDALPVFATAILQVHRNSPDNNPDIPFKFNAQNEKIMAEIIKRYPPQ
YKKAAVMPLLDLGQRQHGFTSISVMNEVARLLEMPPMRVYEVATFYTMYNRTPVGKFFVQACTTTPCQLGGCGSD
VIVDAIKSHLGIKQGQTTADGLFTFIEVECLGACVNAPMIQINDEYYEDLTPESVVQLLDALKESAAKTDVKVPG
PGPLGGRRTCENSKGQTNLLSEPWGAETTRSDL*
Coding >Ophcf2|02000
ATGACGACGGCGGATCGAGACACGCGGGCGTCACTGCCGTCCAAGGAGAGCACGTCTTCATTCTGGCACAGCGAG
CCGTCGCAGAGGCTGCTGGGCCACCGGAGCACGGAACTCGTTCCGACCGAGGCGGACATTGTTGTCATCGGAAGC
GGCATCTCGGGAACGTTTGTGGCCAAGGGGCTCGTCGAGGGGGGCAGGAGGGTGGTGATGCTGGAGGCGAGGGAG
GCTTGCTGGGGGGCTACGGGTCGGAACGGCGGTCACTGCCAGCCCGGAGTGTGGAACAGCTCGCCGTCGGTGGCC
CGCTTCGAACTGGCTACGCTGCACATGCTGGCGGGTTTGGTGGCGGAACAGGGCATCGCCTGCGACTGGCAGCTC
GTCGGCGGCGTGCACGGCCTCTGGTCGACGGCTGAGCTGGAGGCGGCGCGGAAGCAGATGCGACGGCTGGCCAGA
CACGCCCATCTCCGGGACAGTGTCCGGCTGGTGACGGACCGGGATGAGCTCCGGGCACTGCGGCTGGCCGAGGGC
GCCATCGGGGCCGTGGTTCAGAGGCAGGCGGCTGTGCTCTGGCCCTACAAGCTCGTTGCTGCCGTGCTGGAGGCG
TTGCTTGACCGGGGGATGAATCTGCAGACGGGGACGGCCGTTGTTGGGCTGAAGAGGGAGGAGACTGGCGGGGGG
TGGATGGTTGAGACGGAGAGGGGGGTCATTGCGGCGAGGCATGTCGTGCTGGCGACTAACGGGTATACTTCTTAC
CTTTTGCCCTCGATGACGGACCTCATCGTTCCGGTTCAGGGGCAGGTGTGCGCTTTGAAGCCGCCGACGGGATCT
CGCCCGCTGGAGCACAGCTACTCTTGGCTGCCGACGGCGTCGGACGATTACCTTTTGCAGAGGCCTTCCGGAGGC
CTGCTGATCCTTGGCGGCGAGAGGTGTTCGGTGCAGGGGGGTCGGATGGGCATCAGCCGGGATGATGTGGTGGAT
GGGGTTATAGGGGGGAGGTTGAGGCGGGCCATGCGTTCGGCTGTCAAGTTGAGGGGCCGGGGTGAGGAGGAGGAG
GCGGAGTTGGTTGCTGCCATGGAGTGCTCATTATCCGAGGTTTCACCGCGCCAATTGACGTCAGCCCTTTTCCAA
GCTCTCCGCCTCTTGACGTTTCCCGAGACGGACGACTCTGGCCTGGCCTGGCCATTGGCATCGCATCTCACGTCA
CGACATGGCGACGACGCTCTTCCCGTCTTTGCTACGGCGATCTTGCAGGTGCACCGCAACTCGCCCGACAACAAC
CCCGACATCCCCTTCAAGTTCAACGCGCAAAACGAAAAGATCATGGCCGAGATCATCAAGCGGTATCCTCCGCAG
TACAAGAAGGCGGCTGTGATGCCGTTGCTGGACCTCGGTCAGCGCCAGCACGGCTTCACCAGCATCAGCGTCATG
AACGAGGTGGCCAGGCTGTTGGAGATGCCGCCCATGAGGGTGTACGAGGTCGCCACGTTTTATACCATGTATAAT
CGGACGCCCGTGGGCAAGTTTTTCGTCCAGGCTTGCACGACGACTCCCTGTCAGCTGGGCGGGTGCGGCTCCGAC
GTCATCGTCGATGCCATCAAATCGCATCTGGGCATCAAGCAAGGACAGACGACGGCCGATGGCCTCTTCACATTC
ATCGAGGTCGAGTGTCTGGGCGCGTGCGTCAACGCGCCCATGATTCAAATCAACGACGAGTACTACGAGGACCTG
ACGCCCGAGTCGGTGGTTCAGCTTCTCGACGCGCTCAAGGAGAGCGCCGCCAAGACAGACGTCAAGGTTCCGGGG
CCGGGGCCGCTGGGTGGGAGGCGGACGTGCGAGAACAGCAAGGGGCAGACGAATCTGTTGAGTGAGCCTTGGGGG
GCGGAGACGACGAGGTCGGATTTGTGA
Transcript >Ophcf2|02000
ATGACGACGGCGGATCGAGACACGCGGGCGTCACTGCCGTCCAAGGAGAGCACGTCTTCATTCTGGCACAGCGAG
CCGTCGCAGAGGCTGCTGGGCCACCGGAGCACGGAACTCGTTCCGACCGAGGCGGACATTGTTGTCATCGGAAGC
GGCATCTCGGGAACGTTTGTGGCCAAGGGGCTCGTCGAGGGGGGCAGGAGGGTGGTGATGCTGGAGGCGAGGGAG
GCTTGCTGGGGGGCTACGGGTCGGAACGGCGGTCACTGCCAGCCCGGAGTGTGGAACAGCTCGCCGTCGGTGGCC
CGCTTCGAACTGGCTACGCTGCACATGCTGGCGGGTTTGGTGGCGGAACAGGGCATCGCCTGCGACTGGCAGCTC
GTCGGCGGCGTGCACGGCCTCTGGTCGACGGCTGAGCTGGAGGCGGCGCGGAAGCAGATGCGACGGCTGGCCAGA
CACGCCCATCTCCGGGACAGTGTCCGGCTGGTGACGGACCGGGATGAGCTCCGGGCACTGCGGCTGGCCGAGGGC
GCCATCGGGGCCGTGGTTCAGAGGCAGGCGGCTGTGCTCTGGCCCTACAAGCTCGTTGCTGCCGTGCTGGAGGCG
TTGCTTGACCGGGGGATGAATCTGCAGACGGGGACGGCCGTTGTTGGGCTGAAGAGGGAGGAGACTGGCGGGGGG
TGGATGGTTGAGACGGAGAGGGGGGTCATTGCGGCGAGGCATGTCGTGCTGGCGACTAACGGGTATACTTCTTAC
CTTTTGCCCTCGATGACGGACCTCATCGTTCCGGTTCAGGGGCAGGTGTGCGCTTTGAAGCCGCCGACGGGATCT
CGCCCGCTGGAGCACAGCTACTCTTGGCTGCCGACGGCGTCGGACGATTACCTTTTGCAGAGGCCTTCCGGAGGC
CTGCTGATCCTTGGCGGCGAGAGGTGTTCGGTGCAGGGGGGTCGGATGGGCATCAGCCGGGATGATGTGGTGGAT
GGGGTTATAGGGGGGAGGTTGAGGCGGGCCATGCGTTCGGCTGTCAAGTTGAGGGGCCGGGGTGAGGAGGAGGAG
GCGGAGTTGGTTGCTGCCATGGAGTGCTCATTATCCGAGGTTTCACCGCGCCAATTGACGTCAGCCCTTTTCCAA
GCTCTCCGCCTCTTGACGTTTCCCGAGACGGACGACTCTGGCCTGGCCTGGCCATTGGCATCGCATCTCACGTCA
CGACATGGCGACGACGCTCTTCCCGTCTTTGCTACGGCGATCTTGCAGGTGCACCGCAACTCGCCCGACAACAAC
CCCGACATCCCCTTCAAGTTCAACGCGCAAAACGAAAAGATCATGGCCGAGATCATCAAGCGGTATCCTCCGCAG
TACAAGAAGGCGGCTGTGATGCCGTTGCTGGACCTCGGTCAGCGCCAGCACGGCTTCACCAGCATCAGCGTCATG
AACGAGGTGGCCAGGCTGTTGGAGATGCCGCCCATGAGGGTGTACGAGGTCGCCACGTTTTATACCATGTATAAT
CGGACGCCCGTGGGCAAGTTTTTCGTCCAGGCTTGCACGACGACTCCCTGTCAGCTGGGCGGGTGCGGCTCCGAC
GTCATCGTCGATGCCATCAAATCGCATCTGGGCATCAAGCAAGGACAGACGACGGCCGATGGCCTCTTCACATTC
ATCGAGGTCGAGTGTCTGGGCGCGTGCGTCAACGCGCCCATGATTCAAATCAACGACGAGTACTACGAGGACCTG
ACGCCCGAGTCGGTGGTTCAGCTTCTCGACGCGCTCAAGGAGAGCGCCGCCAAGACAGACGTCAAGGTTCCGGGG
CCGGGGCCGCTGGGTGGGAGGCGGACGTGCGAGAACAGCAAGGGGCAGACGAATCTGTTGAGTGAGCCTTGGGGG
GCGGAGACGACGAGGTCGGATTTGTGA
Gene >Ophcf2|02000
ATGACGACGGCGGATCGAGACACGCGGGCGTCACTGCCGTCCAAGGAGAGCACGTCTTCATTCTGGCACAGCGAG
CCGTCGCAGAGGCTGCTGGGCCACCGGAGCACGGAACTCGTTCCGACCGAGGCGGACATTGTTGTCATCGGAAGC
GGCATCTCGGGAACGTTTGTGGCCAAGGGGCTCGTCGAGGGGGGCAGGAGGGTGGTGATGCTGGAGGCGAGGGAG
GCTTGCTGGGGGGCTACGGGTCGGGTGAGTCTTGTCAAGAAACCGGAGTATAGACATCAGGCAAGCTGACAGACG
GTCAGAACGGCGGTCACTGCCAGCCCGGAGTGTGGAACAGCTCGCCGTCGGTGGCCCGCTTCGAACTGGCTACGC
TGCACATGCTGGCGGGTTTGGTGGCGGAACAGGGCATCGCCTGCGACTGGCAGCTCGTCGGCGGCGTGCACGGCC
TCTGGTCGACGGCTGAGCTGGAGGCGGCGCGGAAGCAGATGCGACGGCTGGCCAGACACGCCCATCTCCGGGACA
GTGTCCGGCTGGTGACGGACCGGGATGAGCTCCGGGCACTGCGGCTGGCCGAGGGCGCCATCGGGGCCGTGGTTC
AGAGGCAGGCGGCTGTGCTCTGGCCCTACAAGCTCGTTGCTGCCGTGCTGGAGGCGTTGCTTGACCGGGGGATGA
ATCTGCAGACGGGGACGGCCGTTGTTGGGCTGAAGAGGGAGGAGACTGGCGGGGGGTGGATGGTTGAGACGGAGA
GGGGGGTCATTGCGGCGAGGCATGTCGTGCTGGCGACTAACGGGTATACTTCTTACCTTTTGCCCTCGATGACGG
ACCTCATCGTTCCGGTTCAGGGGCAGGTGTGCGCTTTGAAGCCGCCGACGGGATCTCGCCCGCTGGAGCACAGCT
ACTCTTGGCTGCCGACGGCGTCGGACGATTACCTTTTGCAGAGGCCTTCCGGAGGCCTGCTGATCCTTGGCGGCG
AGAGGTGTTCGGTGCAGGGGGGTCGGATGGGCATCAGCCGGGATGATGTGGTGGATGGGGTTATAGGGGGGAGGT
TGAGGCGGGCCATGCGTTCGGCTGTCAAGTTGAGGGGCCGGGGTGAGGAGGAGGAGGCGGAGTTGGTTGCTGCCA
TGGAGTGGTCTGGCGTGATGGGGTATTCACGAGACGGGCATCCTTGGGTGGGAGCTGTTCCGGGGGAGTTGTTTG
GCGGTGGTGATGCTGAGGGGGAGACGGGGTTATGGATATGTGCTGGGTTTTCGGGGCATGGGATGCCGGTTGCGG
CGAGGTGTGGCGTTGCTGTTGCGGGCATGATTCTTGGGGGGGGGATGGGGTGGAGGTTCCGAGGGAGTTTGGCGT
TGGGGGGGGAGGATGGTGAGGGCTAGGGGAGGGAGATGATGGCTGAGTCGAGGGTTGGGGTTGAGGTTATGCCTG
AGGGTGAGTGGGTTTTGGGGATGGGGTTGTGGTGGGATGGGTTGAGGGTTGAGGGTTGGTGGCTGGTGGTGGCTG
GTTTGTTATGTGAGTTGGTCTGTTGATGAGATGGGTTGACATGGTTGGTATAGTTAGTATGTATTGTAGGATCTG
CATGTTGTGGTTCGACGGATGAGTGGAGATGGAACAATGGCGACTGCGCTCTTGTACTTCCAGTTACTTACAAGT
TACACGAAACACGGACTCATCAGACGCATCTAGCTGTAAGAAAGATGCCATCACAGGTCCGTCGTCGCCAGCGTA
TTGTTGACCTTGCTACAGACCTAGCTTAGCCAAAGCTATAGAATACATATACACTTACAAGAGCTGAGTGAAACA
GCCAATCGTCTTGGTGGCTCAGTTGGTTAGAGCGTTGGTCTCATAGCGATGATCCAATCTCCAGGTTGGGCAATC
CAAAGGTCGCGAGTTCGAGTCTCGCCCAGGACAGGCGATTACTTTTTACAATCAGCTTGACGTTGATTGTTCTTT
TCTTTTTCCCTACCTTTGATCAAACTCTTTCAGGCTGTATGTAGGAGATGCAGATAATTGATCTGATCCTAGCGA
GGTCTAATGACGCTGTCAAGAAATCAGCTAGAGTTAGTACTTGTTGAAGCGCCGACAGTCGCCCGCACAGCTCAT
TATCCGAGGTTTCACCGCGCCAATTGACGTCAGCCCTTTTCCAAGCTCTCCGCCTCTTGACGTTTCCCGAGACGG
ACGACTCTGGCCTGGCCTGGCCATTGGCATCGCATCTCACGTCACGACATGGCGACGACGCTCTTCCCGTCTTTG
CTACGGCGATGTGCGCGTCTGGCTGTTTCTACGCGGCAGACGCGTCCCCTTTCCGCGTCGGGCCGGAGGTTGAGT
GATAGCTTGCAGGTGGTGAGTTGCCTCTGGGTGGCTGGAGCTTTCCATCGCAGAGCTCTGTCTACCGAGGCTTTG
CCCTGCTCCACTGGCTCTCTGCTCTTGTTGGAGCCTCTACTACCTACAGTAGATTCTGCCGAGTCTTCTACGGAG
CCTCTACCCTGGCAGTTCTGCGAGGCCTTGCTAGTCACGAACTCAGCTAACGACGGCAGCACCGCAACTCGCCCG
ACAACAACCCCGACATCCCCTTCAAGTTCAACGCGCAAAACGAAAAGATCATGGCCGAGATCATCAAGCGGTATC
CTCCGCAGTACAAGAAGGCGGCTGTGATGCCGTTGCTGGACCTCGGTCAGCGCCAGCACGGCTTCACCAGCATCA
GCGTCATGAACGAGGTGGCCAGGCTGTTGGAGATGCCGCCCATGAGGGTGTACGAGGTCGCCACGTTTTATACCA
TGTATAATCGGACGCCCGTGGGCAAGTTTTTCGTCCAGGCTTGCACGACGGTATCATATCCCCTCTGATTTTTCT
TGGTTGATGGAAGCTGATGATGGGGGTTTAGACTCCCTGTCAGCTGGGCGGGTGCGGCTCCGACGTCATCGTCGA
TGCCATCAAATCGCATCTGGGCATCAAGCAAGGACAGACGACGGCCGATGGCCTCTTCACATTCATCGAGGTCGA
GTGTCTGGGCGCGTGCGTCAACGCGCCCATGATTCAAATCAACGACGAGTACTACGAGGACCTGACGCCCGAGTC
GGTGGTTCAGCTTCTCGACGCGCTCAAGGAGAGCGCCGCCAAGACAGACGTCAAGGTTCCGGGGCCGGGGCCGCT
GGGTGGGAGGCGGACGTGCGAGAACAGCAAGGGGCAGACGAATCTGTTGAGTGAGCCTTGGGGGGCGGAGACGAC
GAGGTCGGATTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail