Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01999
Gene name
Locationscaffold_02:2333043..2334145
Strand+
Gene length (bp)1102
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07646 Kelch_2 Kelch motif 3.1E-05 76 131

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.624 0.6704 0.0871 0.0649 0.146 0.0501 0.2024 0.2474 0.2234 0.0742

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4511
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1753
Ophiocordyceps australis map64 (Brazil) OphauB2|7329
Ophiocordyceps camponoti-floridani Ophcf2|01999 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|920
Ophiocordyceps kimflemingae Ophio5|1377
Ophiocordyceps subramaniannii Hirsu2|9426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01999
MQSLKGLLTPTARCHRLSAPSPRSSHSLNIISGTAYIFGGHGPHCLDPSVHVIRLPSGGAGPDYFRVEAGPTSPA
PRAGHASATIGARILFFGGRAPSESGNDSNEPLQENGRVWIFDTRSLAWTCLDPLPDSPVPPPRTSPSATATNHP
EPDDSDSNGTLIIHAGILASGEPATDIWSFDLPSRTCRSRLFRFGEAGLHLLPLGLDTFDAQETEVQVFARSPWQ
TTRDGPSASSTAALHALTLGSGRETLVVVLMDGSVQVWLYQVPPHGMTAVSLTHAILQAFGRRTGEGEWTSVRTA
PRDAGGPLPTPRTCFASAPAGHVDGSAIVIWGGIGQEGEILADGCIISLD*
Coding >Ophcf2|01999
ATGCAATCCCTCAAGGGCCTCCTAACCCCAACAGCAAGATGCCACCGCCTCTCCGCCCCCTCCCCCCGCTCCTCC
CACTCCCTAAACATCATCTCCGGAACAGCCTACATCTTCGGCGGTCATGGCCCCCACTGTCTCGATCCCAGCGTC
CACGTCATCCGCTTACCCTCCGGAGGCGCGGGCCCGGATTACTTCCGCGTTGAGGCGGGGCCCACTTCTCCGGCG
CCGAGGGCCGGTCACGCCTCCGCTACTATCGGAGCTCGCATCCTCTTCTTCGGGGGTCGGGCTCCGTCTGAGTCC
GGGAATGATTCCAATGAACCGCTTCAAGAGAATGGCCGTGTCTGGATCTTCGATACCCGTTCCCTCGCCTGGACA
TGCCTCGATCCCCTCCCCGACTCTCCCGTCCCTCCTCCGAGAACGTCCCCCAGCGCAACGGCGACAAACCACCCC
GAACCCGACGACTCAGACTCCAACGGAACCCTCATCATCCACGCCGGAATCCTCGCCTCCGGAGAGCCAGCAACA
GACATCTGGTCCTTCGATCTCCCCTCCCGCACCTGCCGAAGCCGCCTCTTCCGGTTCGGAGAAGCCGGCCTGCAC
CTCCTCCCCCTCGGCCTCGATACCTTTGACGCCCAGGAGACAGAGGTCCAGGTCTTTGCCCGCTCCCCCTGGCAG
ACGACTCGCGACGGACCCTCGGCCAGCTCAACCGCTGCCTTACACGCCTTGACCCTCGGCTCCGGAAGGGAGACC
CTCGTCGTCGTTCTCATGGATGGCTCCGTCCAAGTCTGGCTATATCAGGTTCCTCCGCACGGCATGACGGCCGTC
AGCCTCACTCACGCCATCCTCCAAGCTTTCGGTCGCCGCACGGGCGAGGGCGAATGGACATCCGTTCGGACGGCT
CCGCGTGATGCCGGAGGACCACTCCCTACACCGAGAACATGCTTCGCCAGCGCTCCGGCCGGACACGTCGACGGG
AGCGCCATCGTCATCTGGGGCGGCATCGGACAAGAGGGCGAAATCCTGGCCGACGGCTGCATCATAAGCCTAGAC
TGA
Transcript >Ophcf2|01999
ATGCAATCCCTCAAGGGCCTCCTAACCCCAACAGCAAGATGCCACCGCCTCTCCGCCCCCTCCCCCCGCTCCTCC
CACTCCCTAAACATCATCTCCGGAACAGCCTACATCTTCGGCGGTCATGGCCCCCACTGTCTCGATCCCAGCGTC
CACGTCATCCGCTTACCCTCCGGAGGCGCGGGCCCGGATTACTTCCGCGTTGAGGCGGGGCCCACTTCTCCGGCG
CCGAGGGCCGGTCACGCCTCCGCTACTATCGGAGCTCGCATCCTCTTCTTCGGGGGTCGGGCTCCGTCTGAGTCC
GGGAATGATTCCAATGAACCGCTTCAAGAGAATGGCCGTGTCTGGATCTTCGATACCCGTTCCCTCGCCTGGACA
TGCCTCGATCCCCTCCCCGACTCTCCCGTCCCTCCTCCGAGAACGTCCCCCAGCGCAACGGCGACAAACCACCCC
GAACCCGACGACTCAGACTCCAACGGAACCCTCATCATCCACGCCGGAATCCTCGCCTCCGGAGAGCCAGCAACA
GACATCTGGTCCTTCGATCTCCCCTCCCGCACCTGCCGAAGCCGCCTCTTCCGGTTCGGAGAAGCCGGCCTGCAC
CTCCTCCCCCTCGGCCTCGATACCTTTGACGCCCAGGAGACAGAGGTCCAGGTCTTTGCCCGCTCCCCCTGGCAG
ACGACTCGCGACGGACCCTCGGCCAGCTCAACCGCTGCCTTACACGCCTTGACCCTCGGCTCCGGAAGGGAGACC
CTCGTCGTCGTTCTCATGGATGGCTCCGTCCAAGTCTGGCTATATCAGGTTCCTCCGCACGGCATGACGGCCGTC
AGCCTCACTCACGCCATCCTCCAAGCTTTCGGTCGCCGCACGGGCGAGGGCGAATGGACATCCGTTCGGACGGCT
CCGCGTGATGCCGGAGGACCACTCCCTACACCGAGAACATGCTTCGCCAGCGCTCCGGCCGGACACGTCGACGGG
AGCGCCATCGTCATCTGGGGCGGCATCGGACAAGAGGGCGAAATCCTGGCCGACGGCTGCATCATAAGCCTAGAC
TGA
Gene >Ophcf2|01999
ATGCAATCCCTCAAGGGCCTCCTAACCCCAACAGCAAGATGCCACCGCCTCTCCGCCCCCTCCCCCCGCTCCTCC
CACTCCCTAAACATCATCTCCGGAACAGCCTACATCTTCGGCGGTCATGGCCCCCACTGTCTCGATCCCAGCGTC
CACGTCATCCGCTTACCCTCCGGAGGCGCGGGCCCGGATTACTTCCGCGTTGAGGCGGGGCCCACTTCTCCGGCG
CCGAGGGCCGGTCACGCCTCCGCTACTATCGGAGCTCGCATCCTCTTCTTCGGGGGTCGGGCTCCGTCTGAGTCC
GGGAATGATTCCAATGAACCGCTTCAAGAGAATGGCCGTGTCTGGATCTTCGATACCCGTTCCCTCGCCTGGACA
TGCCTCGATCCCCTCCCCGACTCTCCCGTCCCTCCTCCGAGAACGTCCCCCAGCGCAACGGCGACAAACCACCCC
GAACCCGACGACTCAGACTCCAACGGAACCCTCATCATCCACGCCGGAATCCTCGCCTCCGGAGAGCCAGCAACA
GACATCTGGTCCTTCGATCTCCCCTCCCGCACCTGGTCTCCCTACCTGCACCCCCCCAACCCCCAACACAACCCT
CTGCATAAGCCGAAGCCGCCTCTTCCGGTTCGGAGAAGCCGGCCTGCACCTCCTCCCCCTCGGCCTCGATACCTT
TGACGCCCAGGAGACAGAGGTCCAGGTCTTTGCCCGCTCCCCCTGGCAGACGACTCGCGACGGACCCTCGGCCAG
CTCAACCGCTGCCTTACACGCCTTGACCCTCGGCTCCGGAAGGGAGACCCTCGTCGTCGTTCTCATGGATGGCTC
CGTCCAAGTCTGGCTATATCAGGTTCCTCCGCACGGCATGACGGCCGTCAGCCTCACTCACGCCATCCTCCAAGC
TTTCGGTCGCCGCACGGGCGAGGGCGAATGGACATCCGTTCGGACGGCTCCGCGTGATGCCGGAGGACCACTCCC
TACACCGAGAACATGCTTCGCCAGCGCTCCGGCCGGACACGTCGACGGGAGCGCCATCGTCATCTGGGGCGGCAT
CGGACAAGAGGGCGAAATCCTGGCCGACGGCTGCATCATAAGCCTAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail