Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01995
Gene name
Locationscaffold_02:2324945..2325783
Strand+
Gene length (bp)838
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.155 0.082 0.8705 0.0775 0.0663 0.0091 0.2575 0.2024 0.0765 0.0017

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.99967

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1525
Ophiocordyceps australis map64 (Brazil) OphauB2|391
Ophiocordyceps australis map64 (Brazil) OphauB2|7992
Ophiocordyceps camponoti-floridani Ophcf2|01995 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7171
Ophiocordyceps kimflemingae Ophio5|5939
Ophiocordyceps kimflemingae Ophio5|6574
Ophiocordyceps subramaniannii Hirsu2|3974
Ophiocordyceps subramaniannii Hirsu2|6444

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01995
MKPTAATLLLAALATAKPFPRPDLDPRAVVTKTAWVTEIQYVTEMIDSTTTYWVTATPELDSNRYVQPSPAPEPE
GPEPEEPKTTEAASPPPPPPAPAPPAPKPTYAPPPPPPPAPAPAPTSSASLLLLLLLLLLLAPPAKPAYGGKQGG
YGPGKYSGQITYYTVGMGSCGFDDTGKDQTGNIVAISWAKMGTQSNGNPMCGQTISIHANGKTTQATVRDKCMGC
SENNIDVNEKVFKELFGSLDGGRMPVTWSFN*
Coding >Ophcf2|01995
ATGAAGCCCACCGCAGCCACCCTCCTCCTCGCCGCCCTCGCCACCGCAAAGCCCTTCCCCCGTCCCGACCTGGAC
CCCCGAGCCGTAGTCACCAAAACAGCCTGGGTGACGGAGATCCAGTACGTGACCGAGATGATCGACTCCACCACC
ACCTACTGGGTCACCGCCACCCCGGAGCTGGACTCCAACCGCTACGTCCAGCCCTCTCCCGCCCCGGAACCGGAG
GGGCCCGAACCCGAGGAGCCCAAGACTACAGAGGCCGCTTCTCCTCCGCCCCCACCTCCGGCTCCCGCCCCGCCG
GCCCCGAAGCCGACCTACGCGCCTCCTCCTCCTCCGCCCCCGGCTCCCGCTCCCGCCCCGACCTCCTCCGCCTCC
CTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTGGCCCCCCCCGCCAAGCCAGCCTACGGCGGCAAACAAGGCGGA
TACGGTCCCGGAAAATACAGCGGCCAAATCACCTACTACACCGTCGGGATGGGCTCCTGCGGCTTCGACGACACG
GGCAAGGACCAAACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCCAACGGCAATCCCATG
TGCGGCCAGACCATCAGCATTCACGCCAACGGAAAGACTACGCAGGCTACCGTCAGAGACAAGTGCATGGGCTGC
TCTGAGAACAACATCGACGTCAATGAAAAGGTCTTTAAGGAGCTCTTCGGCAGCCTTGATGGTGGCCGCATGCCC
GTTACCTGGTCTTTCAACTAG
Transcript >Ophcf2|01995
ATGAAGCCCACCGCAGCCACCCTCCTCCTCGCCGCCCTCGCCACCGCAAAGCCCTTCCCCCGTCCCGACCTGGAC
CCCCGAGCCGTAGTCACCAAAACAGCCTGGGTGACGGAGATCCAGTACGTGACCGAGATGATCGACTCCACCACC
ACCTACTGGGTCACCGCCACCCCGGAGCTGGACTCCAACCGCTACGTCCAGCCCTCTCCCGCCCCGGAACCGGAG
GGGCCCGAACCCGAGGAGCCCAAGACTACAGAGGCCGCTTCTCCTCCGCCCCCACCTCCGGCTCCCGCCCCGCCG
GCCCCGAAGCCGACCTACGCGCCTCCTCCTCCTCCGCCCCCGGCTCCCGCTCCCGCCCCGACCTCCTCCGCCTCC
CTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTGGCCCCCCCCGCCAAGCCAGCCTACGGCGGCAAACAAGGCGGA
TACGGTCCCGGAAAATACAGCGGCCAAATCACCTACTACACCGTCGGGATGGGCTCCTGCGGCTTCGACGACACG
GGCAAGGACCAAACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCCAACGGCAATCCCATG
TGCGGCCAGACCATCAGCATTCACGCCAACGGAAAGACTACGCAGGCTACCGTCAGAGACAAGTGCATGGGCTGC
TCTGAGAACAACATCGACGTCAATGAAAAGGTCTTTAAGGAGCTCTTCGGCAGCCTTGATGGTGGCCGCATGCCC
GTTACCTGGTCTTTCAACTAG
Gene >Ophcf2|01995
ATGAAGCCCACCGCAGCCACCCTCCTCCTCGCCGCCCTCGCCACCGCAAAGCCCTTCCCCCGTCCCGACCTGGAC
CCCCGAGCCGTAGTCACCAAAACAGCCTGGGTGACGGAGATCCAGTACGTGACCGAGATGATCGACTCCACCACC
ACCTACTGGGTCACCGCCACCCCGGAGCTGGACTCCAACCGCTACGTCCAGCCCTCTCCCGCCCCGGAACCGGAG
GGGCCCGAACCCGAGGAGCCCAAGACTACAGAGGCCGCTTCTCCTCCGCCCCCACCTCCGGCTCCCGCCCCGCCG
GCCCCGAAGCCGACCTACGCGCCTCCTCCTCCTCCGCCCCCGGCTCCCGCTCCCGCCCCGACCTCCTCCGCCTCC
CTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTGGCCCCCCCCGCCAAGCCAGCCTACGTCCCCCCCCAGCCCCCA
AGCCCGTCCCCGCCCCGGCCCCGTCGTCCCCGCCGCTCAATACGCCGAGGGCGGCAAACAAGGCGGATACGGTCC
CGGAAAATACAGCGGCCAAATCACCTACTACACCGTCGGGATGGGCTCCTGCGGCTTCGACGACACGGGCAAGGA
CCAAACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCCAACGGCAATCCCATGTGCGGCCA
GACCATCAGCATTCACGCCAACGGAAAGACTACGCAGGCTACCGTCAGAGACAAGTGCATGGGCTGCTCTGAGAA
CAACATCGACGTCAATGAAAAGGTCTTTAAGGAGCTCTTCGGCAGCCTTGATGGTGGCCGCATGCCCGTTACCTG
GTCTTTCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail