Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01990
Gene name
Locationscaffold_02:2307638..2310941
Strand+
Gene length (bp)3303
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 126 148 22
2 161 183 22
3 198 220 22
4 227 249 22
5 264 286 22
6 298 320 22
7 335 357 22
8 364 386 22
9 401 423 22
10 537 559 22
11 569 591 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01990
MKGAAVITVLAANLTLAQPTDPALTANLEARDPSGAAGGIGGGIGGGVGGGLGASVPNFRRIRQGNRPVGGGIGG
GIGGGIGGAVRKVRRSKQPAQELGGGIGGGMGGGIGAAVPKIRRRRQPISFGPGTIGGGINGAIGGGIGGAIGSI
SKVQRNKQSSGVASSGLGGGIGGGIGGGVGASVPNFQRNKQPPGADSGLGGGIGGGIGGGIGGGVGVSGVQRNKQ
SAGAASGLGGGIGGGIGGGIGGGVGVSGVQRNKQSAGAASGLGGGIGGGIGGGIGGGVGVSGVQRNKQSAGSGSG
LGGGIGGGIGGGIGGGVGVSGVQRNTQTAGASSGAIGGGFGGGVGGGIGGGVGVSGVQRNKQSAGASSGAIGGGF
GGGIGGGIGGGVAASGVQRNTQAPSGLGGGLGGGIGGGIGGGVGVSGVQRNKQPVGPASGDGLGGGIGGGIGGGV
GGSVPNFRRHEQEDELSGDDVEASEANFPLDTRAAGGAIGGGFGGGIGGGVGGSAPNLNFRRHEEEQFSGDDVEA
SMASFPLDARAAGGAIGGGFGGGIGGGVGGGIASAPSFPRNLQAASGAIGGGFGGGIGGGIGGGVGASAHNFRRH
EQEGELSGDDSDDLEAFVSNFPRDSEAIGGGFGGGIGGGIGGGIASAPNFPRDTQAVGGGFGGGIGGGIGGGIAS
APKFPRDEVPESA*
Coding >Ophcf2|01990
ATGAAGGGAGCCGCCGTCATAACCGTTCTCGCCGCCAACCTCACCCTCGCCCAACCCACCGACCCAGCCTTGACC
GCCAACCTGGAAGCACGAGACCCGAGCGGTGCCGCGGGCGGCATCGGCGGCGGCATCGGCGGCGGTGTTGGAGGC
GGCCTTGGAGCTTCCGTTCCCAACTTCCGGCGGATTAGGCAGGGTAACCGGCCAGTTGGTGGTGGCATCGGCGGT
GGCATTGGCGGCGGCATCGGAGGTGCTGTGAGAAAGGTCCGGCGAAGCAAGCAGCCCGCTCAAGAGCTTGGAGGC
GGAATCGGAGGCGGTATGGGAGGTGGCATTGGAGCTGCCGTCCCCAAGATCCGGCGGCGCAGGCAGCCCATCAGC
TTCGGCCCTGGAACCATCGGAGGTGGCATTAACGGTGCTATCGGAGGTGGTATCGGCGGTGCCATCGGCTCCATC
TCAAAGGTCCAGCGAAACAAGCAGTCCTCCGGGGTTGCCTCGAGCGGTCTTGGAGGAGGAATCGGAGGGGGTATC
GGAGGTGGTGTTGGAGCTTCCGTACCCAACTTTCAACGGAACAAGCAGCCTCCTGGAGCTGATTCCGGGCTTGGA
GGGGGAATCGGTGGTGGCATCGGCGGAGGCATTGGTGGTGGTGTCGGCGTCTCCGGTGTTCAGAGGAACAAGCAG
TCTGCTGGAGCTGCTTCTGGGCTTGGAGGGGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGCGTTGGA
GTTTCCGGCGTTCAGAGGAACAAGCAGTCTGCTGGGGCTGCTTCTGGGCTTGGAGGCGGTATCGGTGGTGGCATC
GGTGGAGGCATTGGTGGTGGCGTTGGCGTTTCTGGCGTCCAGAGGAATAAGCAGTCTGCTGGGTCTGGTTCTGGT
CTTGGAGGAGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGTGTGGGCGTCTCTGGCGTACAGAGAAAC
ACGCAGACTGCTGGAGCTTCTTCCGGAGCTATTGGCGGTGGTTTCGGCGGTGGTGTTGGAGGGGGTATTGGCGGT
GGTGTTGGTGTTTCCGGCGTTCAGAGGAACAAGCAGTCTGCTGGGGCTTCTTCCGGCGCTATTGGCGGTGGTTTC
GGCGGTGGTATTGGGGGGGGCATTGGCGGTGGTGTTGCCGCTTCTGGCGTCCAGCGAAACACGCAGGCTCCTTCT
GGACTTGGAGGAGGCCTTGGCGGTGGCATCGGAGGGGGTATCGGAGGTGGTGTTGGCGTTTCTGGCGTCCAGCGC
AATAAGCAGCCTGTCGGACCTGCCTCTGGAGATGGTCTCGGAGGCGGCATCGGCGGTGGCATCGGCGGCGGTGTT
GGCGGTTCCGTCCCCAACTTCCGCCGGCATGAACAGGAGGATGAGCTCAGCGGCGATGATGTTGAAGCTTCCGAG
GCCAACTTCCCTCTGGATACTCGAGCCGCCGGTGGTGCTATTGGAGGTGGCTTCGGCGGCGGCATCGGCGGCGGT
GTTGGCGGTTCCGCCCCCAATCTCAATTTCCGTCGGCATGAGGAGGAGCAGTTCAGCGGCGACGACGTCGAAGCT
TCCATGGCCAGCTTCCCTCTGGATGCTCGGGCTGCAGGTGGTGCTATTGGAGGGGGCTTCGGAGGGGGTATCGGC
GGTGGCGTTGGCGGTGGCATCGCTTCCGCACCCAGCTTCCCTCGGAATCTTCAGGCTGCCAGCGGTGCCATTGGT
GGTGGTTTCGGAGGCGGCATTGGCGGTGGCATTGGTGGTGGTGTTGGTGCTTCCGCCCACAACTTCCGTCGACAT
GAGCAGGAGGGCGAGCTCAGCGGCGACGATAGCGATGATCTTGAAGCCTTCGTGTCCAACTTTCCCCGAGATAGT
GAGGCTATCGGCGGTGGCTTCGGAGGGGGCATCGGTGGTGGCATCGGCGGTGGAATTGCTTCCGCTCCCAACTTC
CCTCGGGATACTCAGGCTGTCGGCGGTGGCTTCGGAGGGGGCATCGGCGGTGGCATTGGCGGTGGAATTGCTTCC
GCACCCAAATTCCCACGGGATGAAGTCCCGGAAAGCGCTTGA
Transcript >Ophcf2|01990
ATGAAGGGAGCCGCCGTCATAACCGTTCTCGCCGCCAACCTCACCCTCGCCCAACCCACCGACCCAGCCTTGACC
GCCAACCTGGAAGCACGAGACCCGAGCGGTGCCGCGGGCGGCATCGGCGGCGGCATCGGCGGCGGTGTTGGAGGC
GGCCTTGGAGCTTCCGTTCCCAACTTCCGGCGGATTAGGCAGGGTAACCGGCCAGTTGGTGGTGGCATCGGCGGT
GGCATTGGCGGCGGCATCGGAGGTGCTGTGAGAAAGGTCCGGCGAAGCAAGCAGCCCGCTCAAGAGCTTGGAGGC
GGAATCGGAGGCGGTATGGGAGGTGGCATTGGAGCTGCCGTCCCCAAGATCCGGCGGCGCAGGCAGCCCATCAGC
TTCGGCCCTGGAACCATCGGAGGTGGCATTAACGGTGCTATCGGAGGTGGTATCGGCGGTGCCATCGGCTCCATC
TCAAAGGTCCAGCGAAACAAGCAGTCCTCCGGGGTTGCCTCGAGCGGTCTTGGAGGAGGAATCGGAGGGGGTATC
GGAGGTGGTGTTGGAGCTTCCGTACCCAACTTTCAACGGAACAAGCAGCCTCCTGGAGCTGATTCCGGGCTTGGA
GGGGGAATCGGTGGTGGCATCGGCGGAGGCATTGGTGGTGGTGTCGGCGTCTCCGGTGTTCAGAGGAACAAGCAG
TCTGCTGGAGCTGCTTCTGGGCTTGGAGGGGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGCGTTGGA
GTTTCCGGCGTTCAGAGGAACAAGCAGTCTGCTGGGGCTGCTTCTGGGCTTGGAGGCGGTATCGGTGGTGGCATC
GGTGGAGGCATTGGTGGTGGCGTTGGCGTTTCTGGCGTCCAGAGGAATAAGCAGTCTGCTGGGTCTGGTTCTGGT
CTTGGAGGAGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGTGTGGGCGTCTCTGGCGTACAGAGAAAC
ACGCAGACTGCTGGAGCTTCTTCCGGAGCTATTGGCGGTGGTTTCGGCGGTGGTGTTGGAGGGGGTATTGGCGGT
GGTGTTGGTGTTTCCGGCGTTCAGAGGAACAAGCAGTCTGCTGGGGCTTCTTCCGGCGCTATTGGCGGTGGTTTC
GGCGGTGGTATTGGGGGGGGCATTGGCGGTGGTGTTGCCGCTTCTGGCGTCCAGCGAAACACGCAGGCTCCTTCT
GGACTTGGAGGAGGCCTTGGCGGTGGCATCGGAGGGGGTATCGGAGGTGGTGTTGGCGTTTCTGGCGTCCAGCGC
AATAAGCAGCCTGTCGGACCTGCCTCTGGAGATGGTCTCGGAGGCGGCATCGGCGGTGGCATCGGCGGCGGTGTT
GGCGGTTCCGTCCCCAACTTCCGCCGGCATGAACAGGAGGATGAGCTCAGCGGCGATGATGTTGAAGCTTCCGAG
GCCAACTTCCCTCTGGATACTCGAGCCGCCGGTGGTGCTATTGGAGGTGGCTTCGGCGGCGGCATCGGCGGCGGT
GTTGGCGGTTCCGCCCCCAATCTCAATTTCCGTCGGCATGAGGAGGAGCAGTTCAGCGGCGACGACGTCGAAGCT
TCCATGGCCAGCTTCCCTCTGGATGCTCGGGCTGCAGGTGGTGCTATTGGAGGGGGCTTCGGAGGGGGTATCGGC
GGTGGCGTTGGCGGTGGCATCGCTTCCGCACCCAGCTTCCCTCGGAATCTTCAGGCTGCCAGCGGTGCCATTGGT
GGTGGTTTCGGAGGCGGCATTGGCGGTGGCATTGGTGGTGGTGTTGGTGCTTCCGCCCACAACTTCCGTCGACAT
GAGCAGGAGGGCGAGCTCAGCGGCGACGATAGCGATGATCTTGAAGCCTTCGTGTCCAACTTTCCCCGAGATAGT
GAGGCTATCGGCGGTGGCTTCGGAGGGGGCATCGGTGGTGGCATCGGCGGTGGAATTGCTTCCGCTCCCAACTTC
CCTCGGGATACTCAGGCTGTCGGCGGTGGCTTCGGAGGGGGCATCGGCGGTGGCATTGGCGGTGGAATTGCTTCC
GCACCCAAATTCCCACGGGATGAAGTCCCGGAAAGCGCTTGA
Gene >Ophcf2|01990
ATGAAGGGAGCCGCCGTCATAACCGTTCTCGCCGCCAACCTCACCCTCGCCCAACCCACCGACCCAGCCTTGACC
GCCAACCTGGAAGCACGAGACCCGAGCGGTGCCGCGGGCGGCATCGGCGGCGGCATCGGCGGCGGTGTTGGAGGC
GGCCTTGGAGGTGACGATCCTGACATCCCATACTCGGTGCAAGTCAGCTGCTGACAACCACAGCTTCCGTTCCCA
ACTTCCGGCGGATTAGGCAGGGTAACCGGCCAGTTGGTGGTGGCATCGGCGGTGGCATTGGCGGCGGCATCGGAG
GTGAGCGGTTGCAAACACCCATCGCAATCGGATTCTGCTGACAACTACCAGGTGCTGTGAGAAAGGTCCGGCGAA
GCAAGCAGCCCGCTCAAGAGCTTGGAGGCGGAATCGGAGGCGGTATGGGAGGTGGCATTGGAGGTGAGTGTCTCG
AGACAAGTGGTTGCGAGACGAACCTGCTGACAACCGCAGCTGCCGTCCCCAAGATCCGGCGGCGCAGGCAGCCCA
TCAGCTTCGGCCCTGGAACCATCGGAGGTGGCATTAACGGTGCTATCGGAGGTGGTATCGGCGGTGCCATCGGTA
AGAGACTCCAAACACCTTGAGGTAGATCGACCTTGTTGACATCCGTCAGGCTCCATCTCAAAGGTCCAGCGAAAC
AAGCAGTCCTCCGGGGTTGCCTCGAGCGGTCTTGGAGGAGGAATCGGAGGGGGTATCGGAGGTGGTGTTGGAGGT
GAGCTTTCCAAGGCGATTTTCTTGAATCTTTGCTGACAGCTTCTAGCTTCCGTACCCAACTTCCAGCGGAAAAAG
CAGTCTCCTGGGGCTGATTCCGGGCTTGGAGGGGGGGTGGGAGGGGCATCGGAGGCGGTGTTGGAGGTGAGCTCT
TCAAAACAATTTTCTTGCATCTTTTCTGATGGCCGGCCTTAGCTTCCGTACCCAACTTTCAACGGAACAAGCAGC
CTCCTGGAGCTGATTCCGGGCTTGGAGGGGGAATCGGTGGTGGCATCGGCGGAGGCATTGGTGGTGGTGTCGGCG
GTGAGACCTCCCGAGATGATTTTAAAGTCCTCGTACTGACAGCTTCTAGTCTCCGGTGTTCAGAGGAACAAGCAG
TCTGCTGGAGCTGCTTCTGGGCTTGGAGGGGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGCGTTGGA
GGTAAGCCATTCCATTCCATAAGAATCTATCAGGCCTTGTGCTAATAACTTTTAGTTTCCGGCGTTCAGAGGAAC
AAGCAGTCTGCTGGGGCTGCTTCTGGGCTTGGAGGCGGTATCGGTGGTGGCATCGGTGGAGGCATTGGTGGTGGC
GTTGGCGGTAAGCCATCCCGAGATGATTGTCGAGCTTGTGCTAATTGCCTCCAGTTTCTGGCGTCCAGAGGAATA
AGCAGTCTGCTGGGTCTGGTTCTGGTCTTGGAGGAGGAATCGGTGGTGGTATCGGAGGAGGCATCGGTGGTGGTG
TGGGCGGTAAGCCATCCCGAGATCATCTTTCAGGCCTTGTGCTAACAACGTCTAGTCTCTGGCGTACAGAGAAAC
ACGCAGACTGCTGGAGCTTCTTCCGGAGCTATTGGCGGTGGTTTCGGCGGTGGTGTTGGAGGGGGTATTGGCGGT
GGTGTTGGTGGTAAGTCGTTCGAGATTATTCTCGGGCTTGTGCTGATAACGTATAGTTTCCGGCGTTCAGAGGAA
CAAGCAGTCTGCTGGGGCTTCTTCCGGCGCTATTGGCGGTGGTTTCGGCGGTGGTATTGGGGGGGGCATTGGCGG
TGGTGTTGCCGGTGAGCCGCCCCAACGTGATTCCCTTGAGTCCCATGCTCATCTCTTCTAGCTTCTGGCGTCCAG
CGAAACACGCAGGCTCCTTCTGGACTTGGAGGAGGCCTTGGCGGTGGCATCGGAGGGGGTATCGGAGGTGGTGTT
GGCGGTAGGCCCCCAAGATGAATCTCTTCGACCTTCTGCTAACGACCTCTAGTTTCTGGCGTCCAGCGCAATAAG
CAGCCTGTCGGACCTGCCTCTGGAGATGGTCTCGGAGGCGGCATCGGCGGTGGCATCGGCGGCGGTGTTGGCGGT
GAGCTATCCAACATGATATCCAACATGAGTCGTGCTGACAATGTCTAGGTTCCGTCCCCAACTTCCGCCGGCATG
AACAGGAGGATGAGCTCAGCGGCGATGATGTTGAAGGTGAGTCCTGAGACGGCTTGCGGTTCGACCTTGACTGAC
GACCCCTAGCTTCCGAGGCCAACTTCCCTCTGGATACTCGAGCCGCCGGTGGTGCTATTGGAGGTGGCTTCGGCG
GCGGCATCGGCGGCGGTGTTGGCGGTGAGCTTCCAGACGGTTTCCGAATAACATGAACTATGCTGACAGCATCTA
GGTTCCGCCCCCAATCTCAATTTCCGTCGGCATGAGGAGGAGCAGTTCAGCGGCGACGACGTCGAAGGTGAGCTC
GTCATGGCTTGCACTTCGACCTTTACTGACGATGACCAGCTTCCATGGCCAGCTTCCCTCTGGATGCTCGGGCTG
CAGGTGGTGCTATTGGAGGGGGCTTCGGAGGGGGTATCGGCGGTGGCGTTGGCGGTGGCATCGGTGAGCTTCTCT
GACGTTGCAAGTTGAGCCATGCTGACAACCACTAGCTTCCGCACCCAGCTTCCCTCGGAATCTTCAGGCTGCCAG
CGGTGCCATTGGTGGTGGTTTCGGAGGCGGCATTGGCGGTGGCATTGGTGGTGGTGTTGGTGGTGAGCTATCCTG
AGACGGTTTCAAGATGGTATATGCTGACAAGATTCAGCTTCCGCCCACAACTTCCGTCGACATGAGCAGGAGGGC
GAGCTCAGCGGCGACGATAGCGATGATCTTGAAGGTGAATCCTGAGATGGTGTGCAAACTCGACCCTTTGCTGAC
AATCGCTAGCCTTCGTGTCCAACTTTCCCCGAGATAGTGAGGCTATCGGCGGTGGCTTCGGAGGGGGCATCGGTG
GTGGCATCGGCGGTGGAATTGGTGAGCGTCTATGAGATAAAGAGTCGAGCCTTGCTAACAACAACAGCTTCCGCT
CCCAACTTCCCTCGGGATACTCAGGCTGTCGGCGGTGGCTTCGGAGGGGGCATCGGCGGTGGCATTGGCGGTGGA
ATTGGTGAGCATCTTTGAGATTATTAGCTGGACTTGACTGACGACCCCAGCTTCCGCACCCAAATTCCCACGGGA
TGAAGGTGAGAAAGAACCCCAGTCAATGATTCCCAGAGACCTCGCTGACCTCCATCTTCAGTCCCGGAAAGCGCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail