Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01987
Gene name
Locationscaffold_02:2299566..2301133
Strand+
Gene length (bp)1567
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 8.0E-45 136 439

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.754 0.4713 0.0454 0.0624 0.1019 0.0461 0.1768 0.0236 0.2344 0.0051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup916
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7884
Ophiocordyceps australis map64 (Brazil) OphauB2|6393
Ophiocordyceps camponoti-floridani Ophcf2|01987 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2790
Ophiocordyceps kimflemingae Ophio5|4022
Ophiocordyceps subramaniannii Hirsu2|6169

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01987
MAAKIPTQALKGLKVADGSKGANSAPSGDGAGAGDDSDEDSADEENGPVDGGGDAASSAAAAAAAAGKKKKKRKP
RKKKKTPTCQSEPPRVKLSQLFPDGSYPVGEEVEYTDSNRYRTTSEEKRHLDSINSDFLTDYREAAEIHRQVRQY
AQKIIKPGQTLTSIAETIEDGVRALTGHDGLAEGDALKAGMGFPCGLSLNHCAAHYTPNAGNKMVLQQADVLKVD
FGVHVNGRIVDSAFTMAFEPKYDNLLQAVREATNAGIREAGIDARVGEIGAIIQETMESFEVEIDGTTYPVKSIR
NLTGHTILPYSIHGGKAVPIVKSNDQTKMEEGDVFAIETFGSTGNGFVRDDMEVSHYARNSDAQHVDLRLSSAKS
LLSVINKNFGTLPFCRRYLDRLGQDKYLLGLNSLVNSGIVEAYPPLCDKKGSFTAQFEHTILIRPTVKEVISRGE
DY*
Coding >Ophcf2|01987
ATGGCGGCCAAGATTCCCACCCAGGCCCTCAAGGGTCTGAAGGTCGCCGATGGCTCCAAGGGCGCGAACTCGGCG
CCGAGCGGCGATGGCGCCGGCGCAGGCGACGACTCGGACGAAGACTCGGCCGATGAAGAGAATGGCCCCGTCGAT
GGCGGCGGAGATGCTGCTTCTTCTGCTGCTGCTGCTGCTGCCGCTGCCGGTAAGAAGAAAAAGAAGAGAAAGCCG
CGCAAGAAGAAGAAGACGCCGACGTGTCAGTCGGAGCCCCCGCGGGTCAAGCTAAGCCAGCTCTTCCCCGATGGC
AGCTACCCCGTCGGCGAAGAGGTGGAGTACACCGATAGCAATCGATACCGCACTACGAGCGAGGAGAAGCGCCAC
CTGGACAGCATCAACAGCGACTTTCTGACCGACTATCGTGAGGCGGCCGAGATTCACCGCCAGGTGCGCCAATAC
GCGCAAAAGATCATCAAGCCGGGCCAGACTCTGACGTCCATTGCCGAGACGATCGAGGACGGTGTCCGGGCGTTG
ACGGGCCACGATGGCCTGGCCGAGGGCGACGCGCTAAAGGCCGGCATGGGATTCCCTTGCGGTCTTAGCCTCAAC
CACTGCGCCGCCCACTACACGCCCAACGCCGGCAACAAGATGGTGCTGCAGCAGGCTGACGTGCTCAAGGTCGAC
TTTGGCGTCCACGTCAACGGCCGCATCGTCGACTCGGCCTTTACCATGGCCTTTGAGCCCAAGTACGACAATCTG
CTGCAGGCGGTGCGCGAGGCCACAAACGCGGGCATCCGCGAGGCCGGCATCGACGCCCGCGTCGGCGAGATCGGC
GCCATCATCCAGGAGACGATGGAGAGCTTCGAGGTGGAGATTGACGGCACCACCTACCCGGTAAAGAGCATCCGC
AACCTGACGGGCCACACCATCCTGCCATACAGCATCCACGGCGGTAAGGCGGTGCCCATCGTCAAGAGCAACGAC
CAGACCAAGATGGAGGAGGGCGACGTTTTTGCCATCGAGACGTTTGGCAGCACGGGCAACGGTTTCGTCCGTGAC
GACATGGAGGTGTCGCATTACGCGCGCAACAGCGACGCGCAGCACGTCGACCTGCGTCTTAGTTCGGCCAAGTCG
CTGCTGAGCGTCATCAACAAGAACTTTGGCACCTTGCCGTTTTGCCGCCGCTACCTTGACCGGCTGGGCCAGGAC
AAGTACCTGTTGGGGTTGAACAGTCTCGTCAACAGCGGCATCGTCGAGGCGTATCCACCCCTCTGCGATAAGAAG
GGATCCTTTACGGCCCAGTTTGAGCATACGATCCTGATCCGACCGACAGTCAAGGAGGTCATCAGCCGCGGCGAA
GACTATTGA
Transcript >Ophcf2|01987
ATGGCGGCCAAGATTCCCACCCAGGCCCTCAAGGGTCTGAAGGTCGCCGATGGCTCCAAGGGCGCGAACTCGGCG
CCGAGCGGCGATGGCGCCGGCGCAGGCGACGACTCGGACGAAGACTCGGCCGATGAAGAGAATGGCCCCGTCGAT
GGCGGCGGAGATGCTGCTTCTTCTGCTGCTGCTGCTGCTGCCGCTGCCGGTAAGAAGAAAAAGAAGAGAAAGCCG
CGCAAGAAGAAGAAGACGCCGACGTGTCAGTCGGAGCCCCCGCGGGTCAAGCTAAGCCAGCTCTTCCCCGATGGC
AGCTACCCCGTCGGCGAAGAGGTGGAGTACACCGATAGCAATCGATACCGCACTACGAGCGAGGAGAAGCGCCAC
CTGGACAGCATCAACAGCGACTTTCTGACCGACTATCGTGAGGCGGCCGAGATTCACCGCCAGGTGCGCCAATAC
GCGCAAAAGATCATCAAGCCGGGCCAGACTCTGACGTCCATTGCCGAGACGATCGAGGACGGTGTCCGGGCGTTG
ACGGGCCACGATGGCCTGGCCGAGGGCGACGCGCTAAAGGCCGGCATGGGATTCCCTTGCGGTCTTAGCCTCAAC
CACTGCGCCGCCCACTACACGCCCAACGCCGGCAACAAGATGGTGCTGCAGCAGGCTGACGTGCTCAAGGTCGAC
TTTGGCGTCCACGTCAACGGCCGCATCGTCGACTCGGCCTTTACCATGGCCTTTGAGCCCAAGTACGACAATCTG
CTGCAGGCGGTGCGCGAGGCCACAAACGCGGGCATCCGCGAGGCCGGCATCGACGCCCGCGTCGGCGAGATCGGC
GCCATCATCCAGGAGACGATGGAGAGCTTCGAGGTGGAGATTGACGGCACCACCTACCCGGTAAAGAGCATCCGC
AACCTGACGGGCCACACCATCCTGCCATACAGCATCCACGGCGGTAAGGCGGTGCCCATCGTCAAGAGCAACGAC
CAGACCAAGATGGAGGAGGGCGACGTTTTTGCCATCGAGACGTTTGGCAGCACGGGCAACGGTTTCGTCCGTGAC
GACATGGAGGTGTCGCATTACGCGCGCAACAGCGACGCGCAGCACGTCGACCTGCGTCTTAGTTCGGCCAAGTCG
CTGCTGAGCGTCATCAACAAGAACTTTGGCACCTTGCCGTTTTGCCGCCGCTACCTTGACCGGCTGGGCCAGGAC
AAGTACCTGTTGGGGTTGAACAGTCTCGTCAACAGCGGCATCGTCGAGGCGTATCCACCCCTCTGCGATAAGAAG
GGATCCTTTACGGCCCAGTTTGAGCATACGATCCTGATCCGACCGACAGTCAAGGAGGTCATCAGCCGCGGCGAA
GACTATTGA
Gene >Ophcf2|01987
ATGGCGGCCAAGATTCCCACCCAGGCCCTCAAGGGTCTGAAGGGTGAGTCGAAAATAACACCTTGCTATCTATTC
CCAGCGGCATAGTCGGTTACTGATTCCGGTTGCGAAGTCGCCGATGGCTCCAAGGGCGCGAACTCGGCGCCGAGC
GGCGATGGCGCCGGCGCAGGCGACGACTCGGACGAAGACTCGGCCGATGAAGAGAATGGCCCCGTCGATGGCGGC
GGAGATGCTGCTTCTTCTGCTGCTGCTGCTGCTGCCGCTGCCGGTAAGAAGAAAAAGAAGAGAAAGCCGCGCAAG
AAGAAGAAGACGCCGACGTGTCAGTCGGAGCCCCCGCGGGTCAAGCTAAGCCAGCTCTTCCCCGATGGCAGCTAC
CCCGTCGGCGAAGAGGTGGAGTACACCGATAGCAATCGATACCGCACTACGAGCGAGGAGAAGCGCCACCTGGAC
AGCATCAACAGCGACTTTCTGACCGACTATCGTGAGGCGGCCGAGATTCACCGCCAGGTGCGCCAATACGCGCAA
AAGATCATCAAGCCGGGCCAGACTCTGACGTCCATTGCCGAGACGATCGAGGACGGTGTCCGGGCGTTGACGGGC
CACGATGGCCTGGCCGAGGGCGACGCGCTAAAGGCCGGCATGGGATTCCCTTGCGGTCTTAGCCTCAACCACTGC
GCCGCCCACTACACGCCCAACGCCGGCAACAAGATGGTGCTGCAGCAGGCTGACGTGCTCAAGGTCGACTTTGGC
GTCCACGTCAACGGCCGCATCGTCGACTCGGCCTTTACCATGGCCTTTGAGCCCAAGTACGACAATCTGCTGCAG
GCGGTGCGCGAGGCCACAAACGCGGGCATCCGCGAGGCCGGCATCGACGCCCGCGTCGGCGAGATCGGCGCCATC
ATCCAGGAGACGATGGAGAGCTTCGAGGTGGAGATTGACGGCACCACCTACCCGGTAAAGAGCATCCGCAACCTG
ACGGGCCACACCATCCTGCCATACAGCATCCACGGCGGTAAGGCGGTGCCCATCGTCAAGAGCAACGACCAGACC
AAGATGGAGGAGGGCGACGTTTTTGCCATCGAGACGTTTGGCAGCACGGGCAACGGTTTCGTCCGTGACGACATG
GAGGTGTCGCATTACGCGCGCAACAGCGACGCGCAGCACGTCGACCTGCGTCTTAGTTCGGCCAAGTCGCTGCTG
AGCGTCATCAACAAGAACTTTGGCACCTTGCCGTTTTGCCGCCGCTACCTTGACCGGCTGGGCCAGGACAAGTAC
CTGTTGGGGGTGAGCGTTTTCTTTCTTTTATTTATTTATTTTTTTTTACCCAGGGGAGCGTTGCTGATGGTGTGG
GCCGCAGTTGAACAGTCTCGTCAACAGCGGCATCGTCGAGGCGTATCCACCCCTCTGCGATAAGAAGGGATCCTT
TACGGCCCAGTTTGAGCATGTGAGTCTACGCTCCTCGGCCTGCTCTTTGGACGTTTGAAACGCTGATGTATCATG
ACTTCGACAGACGATCCTGATCCGACCGACAGTCAAGGAGGTCATCAGCCGCGGCGAAGACTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail