Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01982
Gene name
Locationscaffold_02:2291232..2292951
Strand+
Gene length (bp)1719
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 3.3E-44 34 371
PF11954 DUF3471 Domain of unknown function (DUF3471) 5.7E-08 413 511

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2093 0.1068 0.7452 0.1403 0.1167 0.0699 0.5399 0.429 0.2229 0.0165

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999761

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup422
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7089
Ophiocordyceps australis map64 (Brazil) OphauB2|7049
Ophiocordyceps camponoti-floridani Ophcf2|01982 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2785
Ophiocordyceps kimflemingae Ophio5|4027
Ophiocordyceps subramaniannii Hirsu2|3858
Ophiocordyceps subramaniannii Hirsu2|5496
Ophiocordyceps subramaniannii Hirsu2|8281

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01982
MRSTLLVVVGVVLAVSAAEQRTSRPSPFTDEFGRFVQDSLHQYHTAGLSIAVIDGGRIIAEGYGNATLPDTPAKP
ETLWYVGSTTKALVAAVLGQLIDSKTYPQLARGWRTPISALIRDDFVLQDGWSTDHVTLEDAATHMSGLTAHDES
LRYSANHSQHIVRDTVRNLRNLPMHLEPHQEFHYNNQMYTVLQHVVETLTGRWLGDLLRDMLWRPLSMGSTYYDL
KQALAGPEHLSTGYYWHRGQGKLKAMPLMPTDPMNASGAVISTVVDFAAWVRCLLRRTEPLSPSVHKELRRPRAV
QNPEPGMGTDVTLYSLGWFRTTLYGQKAYWHSGSVETHGALIYWFPDLDYGVVLFANFPSTVRFVVMWRLIEDKL
RVPRDERFDIGQKMRQDDEKDRRTIANATNILFPDRPRPPLPSSLKPSQLAGRYRHPGYGTFDLRPERKASGDAE
TILVADRDDFEVRYQLRLHHVSGEYWAVFIESPDREPGPSAFYRAQFKLGSDGKVVSLAVTMFNREENVLEGVVV
YERVA*
Coding >Ophcf2|01982
ATGAGGAGCACCTTACTCGTCGTCGTCGGCGTCGTGCTGGCCGTCTCTGCCGCCGAGCAGAGGACCAGCAGGCCG
AGTCCCTTTACCGACGAGTTCGGTCGGTTCGTTCAAGACTCGCTGCATCAGTATCACACGGCGGGACTCTCCATC
GCCGTCATCGATGGGGGCCGCATCATCGCTGAGGGCTATGGCAACGCTACCCTTCCAGACACGCCGGCCAAGCCC
GAAACGCTGTGGTATGTCGGGTCGACGACAAAGGCCCTCGTGGCAGCTGTTCTGGGCCAGCTCATCGACTCCAAG
ACCTATCCGCAACTGGCTCGTGGATGGAGGACGCCCATCTCGGCCCTGATCCGCGATGACTTCGTTCTTCAGGAT
GGCTGGTCCACGGATCACGTCACGCTCGAGGACGCGGCCACTCACATGTCCGGGCTGACGGCTCATGACGAGAGC
CTGCGATACTCGGCCAACCACTCGCAGCACATTGTCCGCGATACGGTCCGCAACCTTCGCAACTTGCCAATGCAT
CTCGAGCCTCACCAAGAGTTCCATTATAACAACCAGATGTACACGGTGCTTCAGCACGTCGTAGAGACGCTGACG
GGCAGGTGGCTCGGTGATTTGCTCAGGGACATGCTCTGGCGTCCGCTCTCCATGGGCTCGACCTATTATGACCTG
AAGCAGGCCCTCGCCGGTCCTGAGCACCTCTCGACCGGATACTACTGGCATCGAGGCCAGGGCAAGCTCAAGGCC
ATGCCGCTGATGCCGACGGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGG
GTCCGCTGTCTGCTGCGCCGCACCGAGCCGCTCTCCCCGTCCGTTCACAAGGAACTGCGCAGGCCGCGGGCGGTG
CAGAACCCGGAGCCCGGCATGGGAACCGACGTCACTCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTATGGC
CAGAAGGCGTATTGGCACTCCGGCTCCGTCGAGACGCACGGCGCCCTCATCTATTGGTTCCCGGACCTCGACTAT
GGCGTCGTCTTGTTCGCAAACTTCCCGAGCACGGTGCGGTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTG
CGGGTGCCCAGAGATGAGCGGTTTGACATTGGCCAAAAGATGAGACAGGATGATGAAAAGGACCGGCGCACCATC
GCCAACGCCACCAACATCCTCTTCCCCGACAGACCGCGTCCTCCGCTGCCATCATCGCTGAAACCTTCACAGCTA
GCCGGCCGGTATCGTCATCCGGGATACGGCACCTTTGACCTGCGGCCAGAGCGAAAGGCATCCGGGGATGCGGAG
ACGATACTGGTGGCGGACCGAGATGACTTCGAAGTGCGGTACCAACTGAGGCTTCACCACGTGTCGGGCGAGTAT
TGGGCCGTCTTCATAGAGTCGCCCGATCGCGAGCCGGGGCCGAGCGCTTTCTACCGCGCCCAGTTCAAATTGGGG
AGCGATGGCAAGGTGGTGAGTCTGGCGGTTACCATGTTTAATCGGGAAGAGAATGTGCTGGAGGGGGTGGTGGTT
TACGAGAGGGTGGCGTGA
Transcript >Ophcf2|01982
ATGAGGAGCACCTTACTCGTCGTCGTCGGCGTCGTGCTGGCCGTCTCTGCCGCCGAGCAGAGGACCAGCAGGCCG
AGTCCCTTTACCGACGAGTTCGGTCGGTTCGTTCAAGACTCGCTGCATCAGTATCACACGGCGGGACTCTCCATC
GCCGTCATCGATGGGGGCCGCATCATCGCTGAGGGCTATGGCAACGCTACCCTTCCAGACACGCCGGCCAAGCCC
GAAACGCTGTGGTATGTCGGGTCGACGACAAAGGCCCTCGTGGCAGCTGTTCTGGGCCAGCTCATCGACTCCAAG
ACCTATCCGCAACTGGCTCGTGGATGGAGGACGCCCATCTCGGCCCTGATCCGCGATGACTTCGTTCTTCAGGAT
GGCTGGTCCACGGATCACGTCACGCTCGAGGACGCGGCCACTCACATGTCCGGGCTGACGGCTCATGACGAGAGC
CTGCGATACTCGGCCAACCACTCGCAGCACATTGTCCGCGATACGGTCCGCAACCTTCGCAACTTGCCAATGCAT
CTCGAGCCTCACCAAGAGTTCCATTATAACAACCAGATGTACACGGTGCTTCAGCACGTCGTAGAGACGCTGACG
GGCAGGTGGCTCGGTGATTTGCTCAGGGACATGCTCTGGCGTCCGCTCTCCATGGGCTCGACCTATTATGACCTG
AAGCAGGCCCTCGCCGGTCCTGAGCACCTCTCGACCGGATACTACTGGCATCGAGGCCAGGGCAAGCTCAAGGCC
ATGCCGCTGATGCCGACGGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGG
GTCCGCTGTCTGCTGCGCCGCACCGAGCCGCTCTCCCCGTCCGTTCACAAGGAACTGCGCAGGCCGCGGGCGGTG
CAGAACCCGGAGCCCGGCATGGGAACCGACGTCACTCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTATGGC
CAGAAGGCGTATTGGCACTCCGGCTCCGTCGAGACGCACGGCGCCCTCATCTATTGGTTCCCGGACCTCGACTAT
GGCGTCGTCTTGTTCGCAAACTTCCCGAGCACGGTGCGGTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTG
CGGGTGCCCAGAGATGAGCGGTTTGACATTGGCCAAAAGATGAGACAGGATGATGAAAAGGACCGGCGCACCATC
GCCAACGCCACCAACATCCTCTTCCCCGACAGACCGCGTCCTCCGCTGCCATCATCGCTGAAACCTTCACAGCTA
GCCGGCCGGTATCGTCATCCGGGATACGGCACCTTTGACCTGCGGCCAGAGCGAAAGGCATCCGGGGATGCGGAG
ACGATACTGGTGGCGGACCGAGATGACTTCGAAGTGCGGTACCAACTGAGGCTTCACCACGTGTCGGGCGAGTAT
TGGGCCGTCTTCATAGAGTCGCCCGATCGCGAGCCGGGGCCGAGCGCTTTCTACCGCGCCCAGTTCAAATTGGGG
AGCGATGGCAAGGTGGTGAGTCTGGCGGTTACCATGTTTAATCGGGAAGAGAATGTGCTGGAGGGGGTGGTGGTT
TACGAGAGGGTGGCGTGA
Gene >Ophcf2|01982
ATGAGGAGCACCTTACTCGTCGTCGTCGGCGTCGTGCTGGCCGTCTCTGCCGCCGAGCAGAGGACCAGCAGGCCG
AGTCCCTTTACCGACGAGTTCGGTCGGTTCGTTCAAGACTCGCTGCATCAGTATCACACGGCGGGACTCTCCATC
GCCGTCATCGATGGGGGCCGCATCATCGCTGAGGTCCGGTACCCGAACAAGCCGACGAGAAGACGCCCGTTGACT
CTCCGCTCTCTTCATAAAATAGGGCTATGGCAACGCTACCCTTCCAGACACGCCGGCCAAGCCCGAAACGCTGTG
GTATGTCGGGTCGACGACAAAGGCCCTCGTGGCAGCTGTTCTGGGCCAGCTCATCGACTCCAAGACCTATCCGCA
ACTGGCTCGTGGATGGAGGACGCCCATCTCGGCCCTGATCCGCGATGACTTCGTTCTTCAGGATGGCTGGTCCAC
GGATCACGTCACGCTCGAGGACGCGGCCACTCACATGTCCGGGCTGACGGCTCATGACGAGAGCCTGCGATACTC
GGCCAACCACTCGCAGCACATTGTCCGCGATACGGTCCGCAACCTTCGCAACTTGCCAATGCATCTCGAGCCTCA
CCAAGAGTTCCATTATAACAACCAGATGTACACGGTGCTTCAGCACGTCGTAGAGACGCTGACGGGCAGGTGGCT
CGGTGATTTGCTCAGGGACATGCTCTGGCGTCCGCTCTCCATGGGCTCGACCTATTATGACCTGAAGCAGGCCCT
CGCCGGTCCTGAGCACCTCTCGACCGGATACTACTGGCATCGAGGCCAGGGCAAGCTCAAGGCCATGCCGCTGAT
GCCGACGGACCCCATGAACGCCTCCGGAGCCGTCATCTCCACCGTCGTCGACTTCGCCGCCTGGGTCCGCTGTCT
GCTGCGCCGCACCGAGCCGCTCTCCCCGTCCGTTCACAAGGAACTGCGCAGGCCGCGGGCGGTGCAGAACCCGGA
GCCCGGCATGGGAACCGACGTCACTCTCTACTCGCTCGGCTGGTTCCGCACCACGCTGTATGGCCAGAAGGCGTA
TTGGCACTCCGGCTCCGTCGAGACGCACGGCGCCCTCATCTATTGGTTCCCGGACCTCGACTATGGCGTCGTCTT
GTTCGCAAACTTCCCGAGCACGGTGCGGTTCGTCGTCATGTGGCGTCTGATCGAGGACAAGCTGCGGGTGCCCAG
AGATGAGCGGTTTGACATTGGCCAAAAGTCGGTTTTTTTCTCCTCCTCATCTTGCCCGTGCATGAGCTGACGCCG
CCATCATGATCCAGGATGAGACAGGATGATGAAAAGGACCGGCGCACCATCGCCAACGCCACCAACATCCTCTTC
CCCGACAGACCGCGTCCTCCGCTGCCATCATCGCTGAAACCTTCACAGCTAGCCGGCCGGTATCGTCATCCGGGA
TACGGCACCTTTGACCTGCGGCCAGAGCGAAAGGCATCCGGGGATGCGGAGACGATACTGGTGGCGGACCGAGAT
GACTTCGAAGTGCGGTACCAACTGAGGCTTCACCACGTGTCGGGCGAGTATTGGGCCGTCTTCATAGAGTCGCCC
GATCGCGAGCCGGGGCCGAGCGCTTTCTACCGCGCCCAGTTCAAATTGGGGAGCGATGGCAAGGTGGTGAGTCTG
GCGGTTACCATGTTTAATCGGGAAGAGAATGTGCTGGAGGGGGTGGTGGTTTACGAGAGGGTGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail