Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01981
Gene name
Locationscaffold_02:2287837..2290379
Strand+
Gene length (bp)2542
Transcript length (bp)2475
Coding sequence length (bp)2475
Protein length (aa) 825

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13426 PAS_9 PAS domain 2.5E-12 259 354

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5816 0.565 0.0765 0.1545 0.106 0.0074 0.1672 0.0655 0.0636 0.0164

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6324
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01981 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2784
Ophiocordyceps kimflemingae Ophio5|4028
Ophiocordyceps subramaniannii Hirsu2|9777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01981
MDPTSPVPRFEPLVEPQMVSRFMANGRGGSDASFEDLSVKPLPLPPTPPPHNDDKDDDDDDDDDDDDDSELPRLQ
TVNGEPYGLDPVDGDDGSFDLVMPAPHGECGDGGGKYELEQRSDLLFSRRHLSAIFDDPAQLHRFSTFLYQHRPA
SVPLLVYYLEALKALRAIDYSNAVLRRLQPPSDLGLDNDSFRSALTSNETLQAKADAAFELLVREDLPMFVTHVW
IGTVTVSIRHRIRGTLPHASEGLAEVFCLTDPSRHDNPIVFMSDEFNRTTQYGVDYVIGRNCRFLQGPHTNPFSV
SRIRDRLLAGVEHYETFLNYRRDGSPFMNLIMLAPLYDSRGAIRYFIGAQVDVSGLVRACYGLGALKRLVQQDKQ
ARQAPPSPARSTDEFTQLAEILGQRELDIVRHHGGDMYRPSPREDLPAPRVPERRSSVRHDASDGSARQRVVLRD
PDSPNLDGTPGEAVGESDGRSITTSASLSVQRNGRLTGVYENYLLVRPYPSLRILFTSPSMRVPGILQTPLLDRV
GGSSRIRKQFVRALSQGQGVTAKVKWLTRLASQRNRPQRKKSQYNHPLEAHLDAGDDTDTLGELEPVGRSRWLHC
TPLTGSNGKVGVWMVVIVDDESEPLSDRRRYGDRHGDRHRPGTDMSEASEDDEPIHGFMSQGKQRPVRPRKSSET
LGIPANMTSKDHDASEERPQPVSSPRRRGRSTSSSPARQSPFYDASTGIFTRHSPFPPPFSSEKGRVAREKLDDG
RVETPMPAWPMPPHVSAPRKKREQQVFVPPAIPETASERAPSRGREDGETSSTRSRFSNRSKGSAYTVRIEEGD*
Coding >Ophcf2|01981
ATGGATCCGACGTCTCCCGTCCCGAGGTTCGAGCCCTTGGTAGAACCGCAGATGGTAAGCAGGTTCATGGCTAAC
GGCCGAGGCGGAAGCGACGCGAGCTTCGAAGACCTCTCCGTCAAGCCGCTTCCCCTTCCGCCGACGCCGCCTCCT
CACAACGACGACAAAGACGACGACGACGACGACGACGACGACGACGATGACGACTCGGAGCTGCCTCGGCTGCAG
ACGGTCAATGGAGAGCCGTACGGGTTGGATCCGGTTGATGGCGATGATGGAAGCTTCGATCTTGTTATGCCCGCG
CCTCATGGGGAGTGTGGTGATGGGGGTGGCAAGTATGAGCTTGAACAGCGGTCTGATTTGCTCTTCTCGAGGAGG
CATCTGAGTGCCATCTTTGACGATCCCGCTCAGTTGCATCGTTTCTCGACCTTTTTATATCAGCACCGACCCGCG
TCCGTTCCGCTGCTCGTCTACTATCTCGAGGCATTAAAGGCATTGCGAGCCATCGACTATAGCAACGCCGTTCTC
CGTCGTCTCCAGCCTCCATCGGACCTGGGCCTTGACAATGACTCTTTCCGGTCAGCGCTTACGTCCAACGAGACG
TTGCAGGCCAAGGCAGACGCCGCCTTTGAGTTGCTGGTACGAGAGGATCTGCCCATGTTCGTCACGCATGTTTGG
ATCGGGACCGTGACCGTCTCGATCCGTCATCGTATCAGGGGGACGTTGCCTCATGCTTCTGAGGGGTTGGCTGAG
GTGTTTTGCTTGACGGATCCTTCGAGGCATGACAATCCCATCGTCTTCATGTCGGATGAGTTCAACCGCACGACG
CAGTACGGAGTCGACTATGTTATAGGTCGGAACTGTCGCTTCCTTCAGGGGCCACATACGAATCCGTTCAGTGTT
TCGCGCATCCGCGATCGTCTGTTGGCTGGGGTCGAGCATTACGAGACGTTTCTCAACTACCGTCGCGATGGTTCA
CCGTTCATGAACCTCATCATGCTCGCACCCCTATACGACTCCCGAGGCGCCATCCGCTACTTCATCGGTGCCCAG
GTCGACGTCTCGGGCCTCGTGAGGGCCTGCTACGGCCTCGGAGCGTTGAAACGCCTCGTCCAACAAGATAAACAA
GCCCGTCAGGCCCCCCCTTCACCGGCTCGTTCCACCGACGAGTTCACCCAGCTGGCCGAGATTCTTGGCCAGCGC
GAGCTCGACATCGTCCGCCATCACGGAGGTGACATGTATAGGCCGTCCCCGCGGGAGGATCTTCCGGCTCCGCGC
GTGCCGGAGAGGCGAAGTTCGGTCCGGCATGATGCTTCTGATGGATCCGCTCGTCAGCGGGTTGTTCTCCGTGAT
CCGGATTCGCCTAATCTCGACGGCACGCCTGGTGAAGCGGTGGGGGAGTCGGATGGTCGATCCATAACGACTTCG
GCCAGTCTGTCCGTTCAACGAAACGGGCGGTTGACGGGCGTCTATGAGAATTACCTGCTCGTTCGACCGTATCCT
TCTCTTCGAATCCTCTTCACCAGCCCATCCATGCGGGTGCCCGGGATCCTTCAGACGCCTCTCCTTGATCGCGTC
GGTGGCTCGTCTCGCATCCGCAAGCAATTCGTCCGTGCTCTATCTCAGGGTCAGGGCGTGACGGCAAAGGTCAAG
TGGCTCACACGCCTAGCCAGTCAAAGAAACCGGCCGCAACGCAAAAAGTCGCAGTACAACCACCCTCTGGAGGCT
CACCTTGACGCCGGTGACGATACCGATACCCTGGGAGAATTGGAGCCCGTCGGCCGGTCCCGGTGGCTTCACTGT
ACGCCTCTGACGGGATCGAATGGAAAGGTTGGCGTGTGGATGGTGGTCATTGTTGACGATGAGTCGGAACCTTTG
TCTGACCGGAGGCGATACGGAGATCGGCACGGAGATCGGCACCGGCCCGGAACGGACATGTCGGAGGCCTCGGAG
GACGACGAACCCATCCACGGGTTCATGTCTCAGGGAAAACAACGACCGGTGCGTCCGCGCAAATCGTCCGAAACA
TTAGGCATTCCTGCCAACATGACGAGCAAAGACCACGATGCTTCCGAAGAGCGTCCTCAGCCCGTGAGCTCCCCT
CGTCGAAGAGGTCGATCAACATCCAGCAGTCCAGCCCGACAATCTCCCTTTTACGACGCCAGCACGGGAATCTTC
ACCCGTCATTCACCCTTCCCTCCGCCATTCAGCTCGGAGAAGGGTCGCGTTGCGCGGGAGAAGCTTGATGACGGT
CGGGTCGAGACGCCGATGCCGGCGTGGCCTATGCCTCCGCACGTGTCGGCGCCGAGGAAGAAGAGGGAGCAGCAG
GTCTTTGTTCCGCCGGCGATCCCGGAGACTGCGTCTGAGAGGGCTCCTAGTCGTGGGAGGGAGGATGGGGAGACG
TCGTCGACTCGGAGTCGCTTTTCGAATAGGAGTAAGGGGTCGGCTTATACCGTCCGGATTGAGGAGGGGGATTGA
Transcript >Ophcf2|01981
ATGGATCCGACGTCTCCCGTCCCGAGGTTCGAGCCCTTGGTAGAACCGCAGATGGTAAGCAGGTTCATGGCTAAC
GGCCGAGGCGGAAGCGACGCGAGCTTCGAAGACCTCTCCGTCAAGCCGCTTCCCCTTCCGCCGACGCCGCCTCCT
CACAACGACGACAAAGACGACGACGACGACGACGACGACGACGACGATGACGACTCGGAGCTGCCTCGGCTGCAG
ACGGTCAATGGAGAGCCGTACGGGTTGGATCCGGTTGATGGCGATGATGGAAGCTTCGATCTTGTTATGCCCGCG
CCTCATGGGGAGTGTGGTGATGGGGGTGGCAAGTATGAGCTTGAACAGCGGTCTGATTTGCTCTTCTCGAGGAGG
CATCTGAGTGCCATCTTTGACGATCCCGCTCAGTTGCATCGTTTCTCGACCTTTTTATATCAGCACCGACCCGCG
TCCGTTCCGCTGCTCGTCTACTATCTCGAGGCATTAAAGGCATTGCGAGCCATCGACTATAGCAACGCCGTTCTC
CGTCGTCTCCAGCCTCCATCGGACCTGGGCCTTGACAATGACTCTTTCCGGTCAGCGCTTACGTCCAACGAGACG
TTGCAGGCCAAGGCAGACGCCGCCTTTGAGTTGCTGGTACGAGAGGATCTGCCCATGTTCGTCACGCATGTTTGG
ATCGGGACCGTGACCGTCTCGATCCGTCATCGTATCAGGGGGACGTTGCCTCATGCTTCTGAGGGGTTGGCTGAG
GTGTTTTGCTTGACGGATCCTTCGAGGCATGACAATCCCATCGTCTTCATGTCGGATGAGTTCAACCGCACGACG
CAGTACGGAGTCGACTATGTTATAGGTCGGAACTGTCGCTTCCTTCAGGGGCCACATACGAATCCGTTCAGTGTT
TCGCGCATCCGCGATCGTCTGTTGGCTGGGGTCGAGCATTACGAGACGTTTCTCAACTACCGTCGCGATGGTTCA
CCGTTCATGAACCTCATCATGCTCGCACCCCTATACGACTCCCGAGGCGCCATCCGCTACTTCATCGGTGCCCAG
GTCGACGTCTCGGGCCTCGTGAGGGCCTGCTACGGCCTCGGAGCGTTGAAACGCCTCGTCCAACAAGATAAACAA
GCCCGTCAGGCCCCCCCTTCACCGGCTCGTTCCACCGACGAGTTCACCCAGCTGGCCGAGATTCTTGGCCAGCGC
GAGCTCGACATCGTCCGCCATCACGGAGGTGACATGTATAGGCCGTCCCCGCGGGAGGATCTTCCGGCTCCGCGC
GTGCCGGAGAGGCGAAGTTCGGTCCGGCATGATGCTTCTGATGGATCCGCTCGTCAGCGGGTTGTTCTCCGTGAT
CCGGATTCGCCTAATCTCGACGGCACGCCTGGTGAAGCGGTGGGGGAGTCGGATGGTCGATCCATAACGACTTCG
GCCAGTCTGTCCGTTCAACGAAACGGGCGGTTGACGGGCGTCTATGAGAATTACCTGCTCGTTCGACCGTATCCT
TCTCTTCGAATCCTCTTCACCAGCCCATCCATGCGGGTGCCCGGGATCCTTCAGACGCCTCTCCTTGATCGCGTC
GGTGGCTCGTCTCGCATCCGCAAGCAATTCGTCCGTGCTCTATCTCAGGGTCAGGGCGTGACGGCAAAGGTCAAG
TGGCTCACACGCCTAGCCAGTCAAAGAAACCGGCCGCAACGCAAAAAGTCGCAGTACAACCACCCTCTGGAGGCT
CACCTTGACGCCGGTGACGATACCGATACCCTGGGAGAATTGGAGCCCGTCGGCCGGTCCCGGTGGCTTCACTGT
ACGCCTCTGACGGGATCGAATGGAAAGGTTGGCGTGTGGATGGTGGTCATTGTTGACGATGAGTCGGAACCTTTG
TCTGACCGGAGGCGATACGGAGATCGGCACGGAGATCGGCACCGGCCCGGAACGGACATGTCGGAGGCCTCGGAG
GACGACGAACCCATCCACGGGTTCATGTCTCAGGGAAAACAACGACCGGTGCGTCCGCGCAAATCGTCCGAAACA
TTAGGCATTCCTGCCAACATGACGAGCAAAGACCACGATGCTTCCGAAGAGCGTCCTCAGCCCGTGAGCTCCCCT
CGTCGAAGAGGTCGATCAACATCCAGCAGTCCAGCCCGACAATCTCCCTTTTACGACGCCAGCACGGGAATCTTC
ACCCGTCATTCACCCTTCCCTCCGCCATTCAGCTCGGAGAAGGGTCGCGTTGCGCGGGAGAAGCTTGATGACGGT
CGGGTCGAGACGCCGATGCCGGCGTGGCCTATGCCTCCGCACGTGTCGGCGCCGAGGAAGAAGAGGGAGCAGCAG
GTCTTTGTTCCGCCGGCGATCCCGGAGACTGCGTCTGAGAGGGCTCCTAGTCGTGGGAGGGAGGATGGGGAGACG
TCGTCGACTCGGAGTCGCTTTTCGAATAGGAGTAAGGGGTCGGCTTATACCGTCCGGATTGAGGAGGGGGATTGA
Gene >Ophcf2|01981
ATGGATCCGACGTCTCCCGTCCCGAGGTTCGAGCCCTTGGTAGAACCGCAGATGGTAAGCAGGTTCATGGCTAAC
GGCCGAGGCGGAAGCGACGCGAGCTTCGAAGACCTCTCCGTCAAGCCGCTTCCCCTTCCGCCGACGCCGCCTCCT
CACAACGACGACAAAGACGACGACGACGACGACGACGACGACGACGATGACGACTCGGAGCTGCCTCGGCTGCAG
ACGGTCAATGGAGAGCCGTACGGGTTGGATCCGGTTGATGGCGATGATGGAAGCTTCGATCTTGTTATGCCCGCG
CCTCATGGGGAGTGTGGTGATGGGGGTGGCAAGTATGAGCTTGAACAGCGGTCTGATTTGCTCTTCTCGAGGAGG
CATCTGAGTGCCATCTTTGACGATCCCGCTCAGTTGCATCGTTTCTCGACCTTTTTATATCAGCACCGACCCGCG
TCCGTTCCGCTGCTCGTCTACTATCTCGAGGCATTAAAGGCATTGCGAGCCATCGACTATAGCAACGCCGTTCTC
CGTCGTCTCCAGCCTCCATCGGACCTGGGCCTTGACAATGACTCTTTCCGGTCAGCGCTTACGTCCAACGAGACG
TTGCAGGCCAAGGCAGACGCCGCCTTTGAGTTGCTGGTACGAGAGGATCTGCCCATGTTCGTCACGCATGTTTGG
ATCGGGACCGTGACCGTCTCGATCCGTCATCGTATCAGGGGGACGTTGCCTCATGCTTCTGAGGGGTTGGCTGAG
GTGTTTTGCTTGACGGATCCTTCGAGGCATGACAATCCCATCGTCTTCATGTCGGATGAGTTCAACCGCACGACG
CAGTACGGAGTCGACTATGTTATAGGTCGGAACTGTCGCTTCCTTCAGGGGCCACATACGAATCCGTTCAGTGTT
TCGCGCATCCGCGATCGTCTGTTGGCTGGGGTCGAGCATTACGAGACGTTTCTCAACTACCGTCGCGATGGTTCA
CCGTTCATGAACCTCATCATGGTGAGAAGACGCCCTTATAGTTGAGCCTGAACCCCTATATCCCCTAACATACCT
GGATTACCCCTAGCTCGCACCCCTATACGACTCCCGAGGCGCCATCCGCTACTTCATCGGTGCCCAGGTCGACGT
CTCGGGCCTCGTGAGGGCCTGCTACGGCCTCGGAGCGTTGAAACGCCTCGTCCAACAAGATAAACAAGCCCGTCA
GGCCCCCCCTTCACCGGCTCGTTCCACCGACGAGTTCACCCAGCTGGCCGAGATTCTTGGCCAGCGCGAGCTCGA
CATCGTCCGCCATCACGGAGGTGACATGTATAGGCCGTCCCCGCGGGAGGATCTTCCGGCTCCGCGCGTGCCGGA
GAGGCGAAGTTCGGTCCGGCATGATGCTTCTGATGGATCCGCTCGTCAGCGGGTTGTTCTCCGTGATCCGGATTC
GCCTAATCTCGACGGCACGCCTGGTGAAGCGGTGGGGGAGTCGGATGGTCGATCCATAACGACTTCGGCCAGTCT
GTCCGTTCAACGAAACGGGCGGTTGACGGGCGTCTATGAGAATTACCTGCTCGTTCGACCGTATCCTTCTCTTCG
AATCCTCTTCACCAGCCCATCCATGCGGGTGCCCGGGATCCTTCAGACGCCTCTCCTTGATCGCGTCGGTGGCTC
GTCTCGCATCCGCAAGCAATTCGTCCGTGCTCTATCTCAGGGTCAGGGCGTGACGGCAAAGGTCAAGTGGCTCAC
ACGCCTAGCCAGTCAAAGAAACCGGCCGCAACGCAAAAAGTCGCAGTACAACCACCCTCTGGAGGCTCACCTTGA
CGCCGGTGACGATACCGATACCCTGGGAGAATTGGAGCCCGTCGGCCGGTCCCGGTGGCTTCACTGTACGCCTCT
GACGGGATCGAATGGAAAGGTTGGCGTGTGGATGGTGGTCATTGTTGACGATGAGTCGGAACCTTTGTCTGACCG
GAGGCGATACGGAGATCGGCACGGAGATCGGCACCGGCCCGGAACGGACATGTCGGAGGCCTCGGAGGACGACGA
ACCCATCCACGGGTTCATGTCTCAGGGAAAACAACGACCGGTGCGTCCGCGCAAATCGTCCGAAACATTAGGCAT
TCCTGCCAACATGACGAGCAAAGACCACGATGCTTCCGAAGAGCGTCCTCAGCCCGTGAGCTCCCCTCGTCGAAG
AGGTCGATCAACATCCAGCAGTCCAGCCCGACAATCTCCCTTTTACGACGCCAGCACGGGAATCTTCACCCGTCA
TTCACCCTTCCCTCCGCCATTCAGCTCGGAGAAGGGTCGCGTTGCGCGGGAGAAGCTTGATGACGGTCGGGTCGA
GACGCCGATGCCGGCGTGGCCTATGCCTCCGCACGTGTCGGCGCCGAGGAAGAAGAGGGAGCAGCAGGTCTTTGT
TCCGCCGGCGATCCCGGAGACTGCGTCTGAGAGGGCTCCTAGTCGTGGGAGGGAGGATGGGGAGACGTCGTCGAC
TCGGAGTCGCTTTTCGAATAGGAGTAAGGGGTCGGCTTATACCGTCCGGATTGAGGAGGGGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail