Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01976
Gene name
Locationscaffold_02:2258558..2261923
Strand-
Gene length (bp)3365
Transcript length (bp)3312
Coding sequence length (bp)3312
Protein length (aa) 1104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00072 Response_reg Response regulator receiver domain 2.1E-27 975 1090
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.4E-23 694 887
PF00512 HisKA His Kinase A (phospho-acceptor) domain 1.5E-14 551 613

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0140299 small molecule sensor activity No
GO:0050794 regulation of cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0004673 protein histidine kinase activity No
GO:0035556 intracellular signal transduction No
GO:0004672 protein kinase activity No
GO:0003674 molecular_function No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 215 237 22
3 392 414 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.87 30.83 80.90
Alive In ants, during behavior modification 36.67 20.59 52.76
Dead In ants, recently dead 39.05 21.79 56.30

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.021710 yes
Alive Dead 0.752291 no
Dead Fungus 0.062813 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01976
MRIGIREQLTAIVILAVFVALATISIPTWVYVHNFVLGVESDGLALTASLKASTIISEINMIQTICKTIASRVLI
QQALVDFYNDNATEPDPFNTARLDLASAMSSTHSTGLLQARLYSRNSTGDSRGLLNVTGDGIGDQVIVLPGPFPD
GKPVFLGDSEQGFPASLYPNLTYESLGFPNPFVPSTQAFVADAFPDVRLNDHGGLLLGPLVVNESFALISLTIPI
SSLNITGFILGYMTIIASSTSLVNVESSREGLSETGIVLLIGPSNPSNRFPITLAPSNATYSPPRDAFVRSPVRL
VLPPPYLEKRPARRDNFGSSFPLSQYPALIDLYYNKNPKPNNATAFLSTKNEQGTPVAVGVARPQSTLVDWAVVV
EKTRDEAYLPIRTLRVILLGCVFGTAILIVFLIVPCAHISVRPIHRLKTATEKSTSPPGYDELDDADVYDESPSS
GGAVSQRSVKGFLGNMRHRMTTAKRKSMTVEAAESHHVFKIPGKVPARKHYVKDELTELTQTFNDMSDELLKQYT
VLDDKVAERTRELEMSKKAAEAANESKTLFIANLSHELKTPLNGIMGMAAICMEEDDIKRIKQSLKTLYKSGDLL
LHLLEDLLSFSKNQIGQSLSLEEKMFRLGDIRTQVLSIFDKQVRESRISFTVAFQSCEPSDSSSSSPDHQVYEKK
LASGGLPHMGRIKDMCLWGDVQRLLQVIINLVSNSLKFTPPDGTVELRIRCVGELDRNRDSTASSPIRDGSLRAP
QSRQRTSASTTRSVSPWAAQRTHMAEKGTALEINPAEPKALPYTQVGERAPTPPPVNAKTYLFEFEVEDTGRGIP
EHMLGKIFEPFVQGDLGLSKKFGGTGLGLAICAQLAGLMGGSIRVKSRLTVGSTFTIQIPLKYVTDRPSSTASSS
VRGSITGDEPTRNSLEQPKSNNQKSSVLEDEQPRLVGLSAPFFAANPNSLPPPIKDQTAAMMEKNKNAVHGQLRV
LVADDNSTNVEVVSRMLKLEDVYDVTIAKDGQEAYDLVKANMEQEQHFDVIFMDIQMPNLDGLQSTRLIRQMGYA
APIVALTAFSEESNVRECRESGMNDFIAKPIRRPALKKVLAAIIEEAETGKGR*
Coding >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGCGATCTCCTC
TTACACCTCCTCGAAGATCTTTTGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATG
TTTCGACTGGGAGACATTAGGACACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTC
ACCGTCGCCTTCCAGTCGTGCGAACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAG
CTGGCCAGTGGTGGGCTCCCGCACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTA
CAAGTCATCATTAACCTGGTCAGCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGC
TGCGTGGGCGAGCTCGACCGGAACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCG
CAGAGCCGGCAGAGGACTTCGGCGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCC
GAAAAGGGCACGGCTCTCGAGATCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCG
CCAACGCCGCCGCCGGTCAACGCAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCG
GAGCATATGCTGGGCAAGATCTTCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACA
GGGCTCGGGCTGGCCATCTGCGCCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACG
GTCGGCTCAACCTTTACCATTCAGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGC
GTCAGGGGCTCCATCACGGGAGACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCG
AGCGTGCTTGAGGACGAGCAGCCGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTG
CCACCGCCGATCAAAGACCAAACGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTG
TTGGTGGCCGATGACAACTCGACCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTG
ACGATTGCCAAGGACGGGCAAGAGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTC
ATCTTCATGGACATCCAGATGCCCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCG
GCTCCCATTGTGGCACTGACAGCCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGAC
TTTATCGCCAAGCCCATCAGGAGGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGC
AAGGGGAGGTAA
Transcript >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGCGATCTCCTC
TTACACCTCCTCGAAGATCTTTTGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATG
TTTCGACTGGGAGACATTAGGACACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTC
ACCGTCGCCTTCCAGTCGTGCGAACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAG
CTGGCCAGTGGTGGGCTCCCGCACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTA
CAAGTCATCATTAACCTGGTCAGCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGC
TGCGTGGGCGAGCTCGACCGGAACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCG
CAGAGCCGGCAGAGGACTTCGGCGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCC
GAAAAGGGCACGGCTCTCGAGATCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCG
CCAACGCCGCCGCCGGTCAACGCAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCG
GAGCATATGCTGGGCAAGATCTTCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACA
GGGCTCGGGCTGGCCATCTGCGCCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACG
GTCGGCTCAACCTTTACCATTCAGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGC
GTCAGGGGCTCCATCACGGGAGACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCG
AGCGTGCTTGAGGACGAGCAGCCGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTG
CCACCGCCGATCAAAGACCAAACGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTG
TTGGTGGCCGATGACAACTCGACCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTG
ACGATTGCCAAGGACGGGCAAGAGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTC
ATCTTCATGGACATCCAGATGCCCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCG
GCTCCCATTGTGGCACTGACAGCCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGAC
TTTATCGCCAAGCCCATCAGGAGGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGC
AAGGGGAGGTAA
Gene >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGTATGTGGCTG
TCCCTCTTGGTAGTCTTTTCTATCGCTGACGATGCTGAGCAGGCGATCTCCTCTTACACCTCCTCGAAGATCTTT
TGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATGTTTCGACTGGGAGACATTAGGA
CACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTCACCGTCGCCTTCCAGTCGTGCG
AACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAGCTGGCCAGTGGTGGGCTCCCGC
ACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTACAAGTCATCATTAACCTGGTCA
GCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGCTGCGTGGGCGAGCTCGACCGGA
ACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCGCAGAGCCGGCAGAGGACTTCGG
CGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCCGAAAAGGGCACGGCTCTCGAGA
TCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCGCCAACGCCGCCGCCGGTCAACG
CAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCGGAGCATATGCTGGGCAAGATCT
TCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACAGGGCTCGGGCTGGCCATCTGCG
CCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACGGTCGGCTCAACCTTTACCATTC
AGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGCGTCAGGGGCTCCATCACGGGAG
ACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCGAGCGTGCTTGAGGACGAGCAGC
CGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTGCCACCGCCGATCAAAGACCAAA
CGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTGTTGGTGGCCGATGACAACTCGA
CCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTGACGATTGCCAAGGACGGGCAAG
AGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTCATCTTCATGGACATCCAGATGC
CCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCGGCTCCCATTGTGGCACTGACAG
CCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGACTTTATCGCCAAGCCCATCAGGA
GGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGCAAGGGGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail