Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01976
Gene name
Locationscaffold_02:2258558..2261923
Strand-
Gene length (bp)3365
Transcript length (bp)3312
Coding sequence length (bp)3312
Protein length (aa) 1104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00072 Response_reg Response regulator receiver domain 2.1E-27 975 1090
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.4E-23 694 887
PF00512 HisKA His Kinase A (phospho-acceptor) domain 1.5E-14 551 613

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0140299 small molecule sensor activity No
GO:0050794 regulation of cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0004673 protein histidine kinase activity No
GO:0035556 intracellular signal transduction No
GO:0004672 protein kinase activity No
GO:0003674 molecular_function No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 215 237 22
3 392 414 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01976
MRIGIREQLTAIVILAVFVALATISIPTWVYVHNFVLGVESDGLALTASLKASTIISEINMIQTICKTIASRVLI
QQALVDFYNDNATEPDPFNTARLDLASAMSSTHSTGLLQARLYSRNSTGDSRGLLNVTGDGIGDQVIVLPGPFPD
GKPVFLGDSEQGFPASLYPNLTYESLGFPNPFVPSTQAFVADAFPDVRLNDHGGLLLGPLVVNESFALISLTIPI
SSLNITGFILGYMTIIASSTSLVNVESSREGLSETGIVLLIGPSNPSNRFPITLAPSNATYSPPRDAFVRSPVRL
VLPPPYLEKRPARRDNFGSSFPLSQYPALIDLYYNKNPKPNNATAFLSTKNEQGTPVAVGVARPQSTLVDWAVVV
EKTRDEAYLPIRTLRVILLGCVFGTAILIVFLIVPCAHISVRPIHRLKTATEKSTSPPGYDELDDADVYDESPSS
GGAVSQRSVKGFLGNMRHRMTTAKRKSMTVEAAESHHVFKIPGKVPARKHYVKDELTELTQTFNDMSDELLKQYT
VLDDKVAERTRELEMSKKAAEAANESKTLFIANLSHELKTPLNGIMGMAAICMEEDDIKRIKQSLKTLYKSGDLL
LHLLEDLLSFSKNQIGQSLSLEEKMFRLGDIRTQVLSIFDKQVRESRISFTVAFQSCEPSDSSSSSPDHQVYEKK
LASGGLPHMGRIKDMCLWGDVQRLLQVIINLVSNSLKFTPPDGTVELRIRCVGELDRNRDSTASSPIRDGSLRAP
QSRQRTSASTTRSVSPWAAQRTHMAEKGTALEINPAEPKALPYTQVGERAPTPPPVNAKTYLFEFEVEDTGRGIP
EHMLGKIFEPFVQGDLGLSKKFGGTGLGLAICAQLAGLMGGSIRVKSRLTVGSTFTIQIPLKYVTDRPSSTASSS
VRGSITGDEPTRNSLEQPKSNNQKSSVLEDEQPRLVGLSAPFFAANPNSLPPPIKDQTAAMMEKNKNAVHGQLRV
LVADDNSTNVEVVSRMLKLEDVYDVTIAKDGQEAYDLVKANMEQEQHFDVIFMDIQMPNLDGLQSTRLIRQMGYA
APIVALTAFSEESNVRECRESGMNDFIAKPIRRPALKKVLAAIIEEAETGKGR*
Coding >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGCGATCTCCTC
TTACACCTCCTCGAAGATCTTTTGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATG
TTTCGACTGGGAGACATTAGGACACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTC
ACCGTCGCCTTCCAGTCGTGCGAACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAG
CTGGCCAGTGGTGGGCTCCCGCACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTA
CAAGTCATCATTAACCTGGTCAGCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGC
TGCGTGGGCGAGCTCGACCGGAACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCG
CAGAGCCGGCAGAGGACTTCGGCGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCC
GAAAAGGGCACGGCTCTCGAGATCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCG
CCAACGCCGCCGCCGGTCAACGCAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCG
GAGCATATGCTGGGCAAGATCTTCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACA
GGGCTCGGGCTGGCCATCTGCGCCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACG
GTCGGCTCAACCTTTACCATTCAGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGC
GTCAGGGGCTCCATCACGGGAGACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCG
AGCGTGCTTGAGGACGAGCAGCCGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTG
CCACCGCCGATCAAAGACCAAACGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTG
TTGGTGGCCGATGACAACTCGACCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTG
ACGATTGCCAAGGACGGGCAAGAGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTC
ATCTTCATGGACATCCAGATGCCCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCG
GCTCCCATTGTGGCACTGACAGCCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGAC
TTTATCGCCAAGCCCATCAGGAGGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGC
AAGGGGAGGTAA
Transcript >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGCGATCTCCTC
TTACACCTCCTCGAAGATCTTTTGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATG
TTTCGACTGGGAGACATTAGGACACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTC
ACCGTCGCCTTCCAGTCGTGCGAACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAG
CTGGCCAGTGGTGGGCTCCCGCACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTA
CAAGTCATCATTAACCTGGTCAGCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGC
TGCGTGGGCGAGCTCGACCGGAACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCG
CAGAGCCGGCAGAGGACTTCGGCGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCC
GAAAAGGGCACGGCTCTCGAGATCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCG
CCAACGCCGCCGCCGGTCAACGCAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCG
GAGCATATGCTGGGCAAGATCTTCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACA
GGGCTCGGGCTGGCCATCTGCGCCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACG
GTCGGCTCAACCTTTACCATTCAGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGC
GTCAGGGGCTCCATCACGGGAGACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCG
AGCGTGCTTGAGGACGAGCAGCCGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTG
CCACCGCCGATCAAAGACCAAACGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTG
TTGGTGGCCGATGACAACTCGACCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTG
ACGATTGCCAAGGACGGGCAAGAGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTC
ATCTTCATGGACATCCAGATGCCCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCG
GCTCCCATTGTGGCACTGACAGCCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGAC
TTTATCGCCAAGCCCATCAGGAGGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGC
AAGGGGAGGTAA
Gene >Ophcf2|01976
ATGCGGATCGGCATCCGGGAGCAGCTCACAGCGATAGTAATCTTGGCCGTCTTCGTCGCCCTCGCCACAATCTCC
ATCCCGACATGGGTCTACGTTCACAACTTCGTCCTCGGCGTCGAGTCGGATGGCCTCGCCTTGACGGCCTCACTC
AAGGCCTCGACCATCATCTCCGAGATCAATATGATCCAGACCATCTGCAAAACCATCGCCAGTCGCGTTCTCATT
CAGCAGGCCTTGGTCGACTTTTACAATGACAACGCCACCGAGCCGGACCCCTTTAACACCGCCCGCCTCGACCTG
GCCAGCGCCATGAGCAGTACCCACAGCACCGGCCTGCTCCAAGCTCGTCTCTACTCGAGGAACTCGACCGGTGAC
TCTCGCGGTCTGCTCAACGTCACCGGTGACGGCATCGGAGACCAGGTCATTGTTCTCCCCGGGCCTTTCCCGGAT
GGCAAGCCCGTCTTTCTCGGCGATTCCGAGCAGGGCTTCCCTGCCAGTCTCTACCCGAACCTGACGTACGAGAGT
CTGGGCTTCCCGAACCCCTTTGTGCCATCCACGCAGGCCTTTGTTGCCGACGCCTTTCCGGACGTGAGGCTCAAT
GATCACGGTGGTCTTCTCCTGGGTCCTTTGGTGGTCAACGAGTCGTTTGCCCTCATCTCCCTCACCATCCCCATC
AGCTCGCTCAACATTACCGGCTTCATCCTCGGCTACATGACCATCATAGCGTCGTCGACGTCCCTTGTCAACGTC
GAGTCCTCTCGCGAAGGCCTCAGTGAAACGGGCATCGTCCTCCTCATCGGCCCCAGCAACCCCTCGAACCGTTTC
CCCATCACTCTGGCCCCGAGCAACGCAACCTATTCTCCCCCGCGGGACGCCTTTGTGCGTTCCCCGGTTCGTCTC
GTCCTGCCTCCGCCATACCTCGAAAAACGGCCGGCTCGCCGTGATAACTTTGGCTCCTCGTTTCCGCTATCTCAG
TATCCCGCTCTCATAGACCTCTACTACAACAAGAATCCCAAGCCCAATAACGCCACGGCCTTTTTATCCACCAAG
AATGAGCAGGGCACCCCGGTGGCCGTCGGCGTCGCCCGGCCGCAGTCGACGCTGGTTGACTGGGCTGTCGTAGTG
GAAAAGACTCGGGACGAGGCGTATCTGCCGATTCGTACCCTCAGGGTCATCCTGTTGGGCTGCGTCTTTGGCACA
GCTATCCTTATCGTCTTCCTGATCGTTCCCTGCGCCCACATCAGCGTCCGGCCTATACATCGGCTCAAGACTGCG
ACGGAAAAGTCGACCAGCCCGCCTGGCTACGACGAGCTGGACGATGCTGATGTCTACGACGAGAGCCCGAGCTCG
GGTGGCGCCGTCAGTCAGAGGTCCGTCAAGGGCTTCCTCGGCAACATGCGGCATAGGATGACGACGGCCAAGAGG
AAGTCGATGACGGTCGAGGCGGCCGAGTCTCATCACGTCTTCAAGATTCCCGGCAAGGTTCCGGCCCGGAAGCAC
TACGTCAAGGACGAGCTCACGGAGCTGACGCAGACGTTCAACGACATGTCGGACGAGCTGCTGAAGCAGTATACA
GTCCTGGACGACAAGGTGGCCGAGAGGACTCGCGAACTGGAGATGAGCAAGAAGGCGGCCGAGGCTGCTAATGAG
AGTAAGACGCTCTTTATTGCGAACCTCTCTCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCC
ATTTGTATGGAGGAGGACGACATTAAGCGCATCAAGCAGTCGCTCAAGACGTTGTACAAGTCGGGTATGTGGCTG
TCCCTCTTGGTAGTCTTTTCTATCGCTGACGATGCTGAGCAGGCGATCTCCTCTTACACCTCCTCGAAGATCTTT
TGAGCTTCTCAAAGAACCAGATCGGTCAAAGCTTGAGCCTCGAAGAAAAAATGTTTCGACTGGGAGACATTAGGA
CACAGGTGCTCTCCATCTTCGACAAGCAGGTCAGGGAGAGCCGCATCTCCTTCACCGTCGCCTTCCAGTCGTGCG
AACCGAGCGACTCAAGCTCATCGAGTCCGGATCACCAGGTATACGAGAAGAAGCTGGCCAGTGGTGGGCTCCCGC
ACATGGGACGCATCAAGGACATGTGTCTCTGGGGAGACGTGCAGAGGCTGCTACAAGTCATCATTAACCTGGTCA
GCAACAGCCTCAAGTTTACGCCTCCGGACGGCACGGTCGAGCTGAGGATTCGCTGCGTGGGCGAGCTCGACCGGA
ACCGGGACAGCACGGCCTCATCCCCGATCCGGGACGGCTCCTTGAGGGCTCCGCAGAGCCGGCAGAGGACTTCGG
CGTCGACGACGCGATCCGTCAGCCCCTGGGCGGCGCAGAGAACGCACATGGCCGAAAAGGGCACGGCTCTCGAGA
TCAATCCAGCCGAACCAAAGGCTCTGCCGTACACGCAGGTGGGTGAGCGAGCGCCAACGCCGCCGCCGGTCAACG
CAAAGACGTACCTGTTCGAGTTCGAGGTCGAGGACACGGGCCGCGGCATCCCGGAGCATATGCTGGGCAAGATCT
TCGAGCCCTTTGTTCAAGGCGACCTGGGCCTCAGCAAGAAGTTTGGCGGGACAGGGCTCGGGCTGGCCATCTGCG
CCCAGCTGGCCGGGCTCATGGGCGGCTCGATCCGGGTAAAGAGCAGGCTTACGGTCGGCTCAACCTTTACCATTC
AGATCCCGCTCAAGTACGTGACGGACCGACCGTCGAGCACGGCGTCGAGCAGCGTCAGGGGCTCCATCACGGGAG
ACGAGCCAACGCGTAACTCGCTCGAACAGCCAAAGTCCAACAACCAGAAGTCGAGCGTGCTTGAGGACGAGCAGC
CGCGACTGGTGGGCCTCAGCGCGCCCTTTTTCGCCGCCAACCCCAACTCGCTGCCACCGCCGATCAAAGACCAAA
CGGCAGCCATGATGGAAAAGAACAAGAACGCCGTCCACGGTCAGCTTCGTGTGTTGGTGGCCGATGACAACTCGA
CCAACGTTGAGGTGGTCAGCAGGATGCTCAAGCTCGAGGATGTCTACGACGTGACGATTGCCAAGGACGGGCAAG
AGGCCTACGACCTGGTCAAGGCAAACATGGAACAGGAGCAGCACTTTGACGTCATCTTCATGGACATCCAGATGC
CCAACCTAGACGGGCTGCAATCGACGCGGCTGATCCGGCAGATGGGCTACGCGGCTCCCATTGTGGCACTGACAG
CCTTTTCGGAGGAGAGCAACGTGCGCGAGTGTCGAGAGTCGGGCATGAACGACTTTATCGCCAAGCCCATCAGGA
GGCCGGCGCTTAAGAAGGTGTTGGCCGCCATCATCGAGGAGGCCGAGACGGGCAAGGGGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail