Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01968
Gene name
Locationscaffold_02:2244270..2246106
Strand+
Gene length (bp)1836
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13402 Peptidase_M60 Peptidase M60, enhancin and enhancin-like 7.6E-48 318 576
PF17291 M60-like_N N-terminal domain of M60-like peptidases 1.8E-11 203 309

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2176 0.2077 0.895 0.1611 0.1554 0.0282 0.1993 0.2128 0.2352 0.0152

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.99972

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup466
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5541
Ophiocordyceps australis map64 (Brazil) OphauB2|3772
Ophiocordyceps australis map64 (Brazil) OphauB2|5622
Ophiocordyceps australis map64 (Brazil) OphauB2|59
Ophiocordyceps camponoti-floridani Ophcf2|01968 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3885
Ophiocordyceps kimflemingae Ophio5|4029
Ophiocordyceps subramaniannii Hirsu2|10122

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01968
MARLKPRLSLLTTLLLINVSNATPFQNTTLHVTDRQQPTPPFSNTSTPLADLQVHQQSSTLYPLQKQTIWVRAGN
AGPSTEMTLVLESPPLKGVGLSITHVSGGCEQTGLASERIRCEWRGVKESVDFHLEIGLRYDGFSSVERIEMPLT
LTAYLDRHGPDVSFRRIHSLHWKIRYAERYEYNTSNNKYFPHPSVIRVKAVPRAADEARRLRQWFQWADFEPTGF
YLRPQESLQMVVLGGSATGPRPDLLIGTPGLVNARRRSDNSLIGQQRIKPLKFGVNRISCPVGGIMYIRYAFPKE
SIPPPDVTVVLYGDEAAQPFPLFRQGITTDEQWGEMLRVTNIPYAELSGRRVMVTGLAEDAQRYAWLGQKQDELL
ETYESIINAQDRISGLFRHGSSARHRPSPLRPMVMQTSNGRNAHAWHLRAALPAREHQDIWRKASVENSWQLWHE
LGHQRQHIYTWSWPQVQESTVNIYALASRRMWPQRATEHGSSREWDEARRYLAERTVDFDHADHFVQLAMFDQLR
QVFGDDFYHQLHALSRQSPTQRGPKEKKNFFMTRASLVARQDLSGFFEKWGMEPDEETLSWMRVLPEPRWDYTLT
PAFVPVSVKQL*
Coding >Ophcf2|01968
ATGGCTCGTCTCAAACCCAGACTCTCTCTACTAACCACGCTCCTCCTCATAAACGTCTCCAACGCAACGCCCTTT
CAAAACACCACTCTACACGTAACCGACCGCCAGCAACCAACCCCCCCCTTCAGCAACACCAGCACCCCCCTCGCA
GACCTTCAAGTCCACCAGCAATCGTCGACGCTATACCCCCTGCAGAAGCAAACAATCTGGGTGAGAGCGGGAAAC
GCGGGTCCCAGCACGGAGATGACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTGGGCTTAAGCATCACACAT
GTTTCCGGCGGCTGTGAGCAGACGGGATTGGCGTCGGAGAGGATCCGCTGCGAGTGGAGAGGTGTTAAGGAGTCG
GTCGACTTTCATCTCGAGATTGGGCTGAGATACGATGGCTTCTCTTCGGTTGAAAGGATCGAAATGCCCTTGACG
TTGACGGCTTACCTCGACCGTCACGGCCCTGACGTATCCTTCCGACGCATCCACAGCCTTCACTGGAAGATTCGA
TACGCAGAGAGATACGAATACAACACGTCCAACAACAAATACTTCCCACACCCGTCCGTCATCAGAGTCAAGGCC
GTCCCCCGGGCAGCAGACGAAGCCCGCCGTCTCCGTCAATGGTTCCAATGGGCCGACTTCGAACCAACGGGCTTC
TACCTCCGACCGCAGGAATCGCTCCAGATGGTCGTCCTCGGCGGATCAGCAACCGGCCCTCGCCCGGATCTCCTC
ATCGGCACTCCAGGGCTGGTCAACGCCCGGAGACGAAGCGACAACTCGCTCATCGGACAGCAGCGAATCAAGCCG
CTCAAGTTCGGGGTCAACCGCATCTCTTGTCCCGTCGGGGGCATCATGTACATCCGATACGCGTTTCCCAAGGAG
TCGATACCGCCGCCTGACGTGACCGTCGTTTTATACGGAGACGAGGCTGCTCAGCCGTTTCCGCTCTTCCGGCAG
GGAATCACGACGGACGAGCAATGGGGAGAGATGCTGCGAGTCACAAACATTCCCTACGCCGAACTATCCGGCCGA
CGCGTCATGGTGACAGGTCTGGCAGAAGACGCCCAGAGATACGCCTGGCTCGGACAGAAACAAGACGAGCTACTG
GAGACGTACGAAAGCATCATCAACGCACAGGACAGGATAAGCGGCCTCTTCCGTCACGGCTCATCAGCTCGGCAC
CGCCCCAGCCCACTACGACCGATGGTAATGCAGACTTCCAACGGCCGCAACGCCCACGCATGGCACCTCCGAGCC
GCGCTCCCGGCCCGAGAACACCAAGACATCTGGCGCAAGGCAAGCGTAGAGAACTCATGGCAACTCTGGCACGAG
CTCGGCCACCAACGGCAGCACATCTACACCTGGAGCTGGCCGCAGGTACAGGAATCGACCGTCAACATCTACGCG
CTGGCCAGCCGAAGGATGTGGCCGCAGAGAGCGACGGAGCACGGCTCGAGCAGAGAATGGGATGAGGCCAGACGA
TACCTCGCCGAGCGAACCGTCGACTTCGACCACGCAGATCACTTCGTTCAACTGGCCATGTTCGACCAACTCCGC
CAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGCCAATCGCCGACCCAGCGCGGGCCCAAA
GAGAAGAAGAACTTCTTCATGACGCGCGCCTCTCTCGTCGCCCGGCAGGATCTGAGCGGCTTTTTCGAGAAATGG
GGCATGGAGCCGGACGAGGAGACCTTGTCGTGGATGAGGGTGCTGCCGGAGCCGCGGTGGGATTATACGCTTACG
CCTGCGTTTGTGCCCGTTTCTGTCAAACAGCTATAA
Transcript >Ophcf2|01968
ATGGCTCGTCTCAAACCCAGACTCTCTCTACTAACCACGCTCCTCCTCATAAACGTCTCCAACGCAACGCCCTTT
CAAAACACCACTCTACACGTAACCGACCGCCAGCAACCAACCCCCCCCTTCAGCAACACCAGCACCCCCCTCGCA
GACCTTCAAGTCCACCAGCAATCGTCGACGCTATACCCCCTGCAGAAGCAAACAATCTGGGTGAGAGCGGGAAAC
GCGGGTCCCAGCACGGAGATGACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTGGGCTTAAGCATCACACAT
GTTTCCGGCGGCTGTGAGCAGACGGGATTGGCGTCGGAGAGGATCCGCTGCGAGTGGAGAGGTGTTAAGGAGTCG
GTCGACTTTCATCTCGAGATTGGGCTGAGATACGATGGCTTCTCTTCGGTTGAAAGGATCGAAATGCCCTTGACG
TTGACGGCTTACCTCGACCGTCACGGCCCTGACGTATCCTTCCGACGCATCCACAGCCTTCACTGGAAGATTCGA
TACGCAGAGAGATACGAATACAACACGTCCAACAACAAATACTTCCCACACCCGTCCGTCATCAGAGTCAAGGCC
GTCCCCCGGGCAGCAGACGAAGCCCGCCGTCTCCGTCAATGGTTCCAATGGGCCGACTTCGAACCAACGGGCTTC
TACCTCCGACCGCAGGAATCGCTCCAGATGGTCGTCCTCGGCGGATCAGCAACCGGCCCTCGCCCGGATCTCCTC
ATCGGCACTCCAGGGCTGGTCAACGCCCGGAGACGAAGCGACAACTCGCTCATCGGACAGCAGCGAATCAAGCCG
CTCAAGTTCGGGGTCAACCGCATCTCTTGTCCCGTCGGGGGCATCATGTACATCCGATACGCGTTTCCCAAGGAG
TCGATACCGCCGCCTGACGTGACCGTCGTTTTATACGGAGACGAGGCTGCTCAGCCGTTTCCGCTCTTCCGGCAG
GGAATCACGACGGACGAGCAATGGGGAGAGATGCTGCGAGTCACAAACATTCCCTACGCCGAACTATCCGGCCGA
CGCGTCATGGTGACAGGTCTGGCAGAAGACGCCCAGAGATACGCCTGGCTCGGACAGAAACAAGACGAGCTACTG
GAGACGTACGAAAGCATCATCAACGCACAGGACAGGATAAGCGGCCTCTTCCGTCACGGCTCATCAGCTCGGCAC
CGCCCCAGCCCACTACGACCGATGGTAATGCAGACTTCCAACGGCCGCAACGCCCACGCATGGCACCTCCGAGCC
GCGCTCCCGGCCCGAGAACACCAAGACATCTGGCGCAAGGCAAGCGTAGAGAACTCATGGCAACTCTGGCACGAG
CTCGGCCACCAACGGCAGCACATCTACACCTGGAGCTGGCCGCAGGTACAGGAATCGACCGTCAACATCTACGCG
CTGGCCAGCCGAAGGATGTGGCCGCAGAGAGCGACGGAGCACGGCTCGAGCAGAGAATGGGATGAGGCCAGACGA
TACCTCGCCGAGCGAACCGTCGACTTCGACCACGCAGATCACTTCGTTCAACTGGCCATGTTCGACCAACTCCGC
CAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGCCAATCGCCGACCCAGCGCGGGCCCAAA
GAGAAGAAGAACTTCTTCATGACGCGCGCCTCTCTCGTCGCCCGGCAGGATCTGAGCGGCTTTTTCGAGAAATGG
GGCATGGAGCCGGACGAGGAGACCTTGTCGTGGATGAGGGTGCTGCCGGAGCCGCGGTGGGATTATACGCTTACG
CCTGCGTTTGTGCCCGTTTCTGTCAAACAGCTATAA
Gene >Ophcf2|01968
ATGGCTCGTCTCAAACCCAGACTCTCTCTACTAACCACGCTCCTCCTCATAAACGTCTCCAACGCAACGCCCTTT
CAAAACACCACTCTACACGTAACCGACCGCCAGCAACCAACCCCCCCCTTCAGCAACACCAGCACCCCCCTCGCA
GACCTTCAAGTCCACCAGCAATCGTCGACGCTATACCCCCTGCAGAAGCAAACAATCTGGGTGAGAGCGGGAAAC
GCGGGTCCCAGCACGGAGATGACGCTGGTGCTCGAGTCGCCGCCGCTCAAGGGGGTGGGCTTAAGCATCACACAT
GTTTCCGGCGGCTGTGAGCAGACGGGATTGGCGTCGGAGAGGATCCGCTGCGAGTGGAGAGGTGTTAAGGAGTCG
GTCGACTTTCATCTCGAGATTGGGCTGAGATACGATGGCTTCTCTTCGGTTGAAAGGATCGAAATGCCCTTGACG
TTGACGGCTTACCTCGACCGTCACGGCCCTGACGTATCCTTCCGACGCATCCACAGCCTTCACTGGAAGATTCGA
TACGCAGAGAGATACGAATACAACACGTCCAACAACAAATACTTCCCACACCCGTCCGTCATCAGAGTCAAGGCC
GTCCCCCGGGCAGCAGACGAAGCCCGCCGTCTCCGTCAATGGTTCCAATGGGCCGACTTCGAACCAACGGGCTTC
TACCTCCGACCGCAGGAATCGCTCCAGATGGTCGTCCTCGGCGGATCAGCAACCGGCCCTCGCCCGGATCTCCTC
ATCGGCACTCCAGGGCTGGTCAACGCCCGGAGACGAAGCGACAACTCGCTCATCGGACAGCAGCGAATCAAGCCG
CTCAAGTTCGGGGTCAACCGCATCTCTTGTCCCGTCGGGGGCATCATGTACATCCGATACGCGTTTCCCAAGGAG
TCGATACCGCCGCCTGACGTGACCGTCGTTTTATACGGAGACGAGGCTGCTCAGCCGTTTCCGCTCTTCCGGCAG
GGAATCACGACGGACGAGCAATGGGGAGAGATGCTGCGAGTCACAAACATTCCCTACGCCGAACTATCCGGCCGA
CGCGTCATGGTGACAGGTCTGGCAGAAGACGCCCAGAGATACGCCTGGCTCGGACAGAAACAAGACGAGCTACTG
GAGACGTACGAAAGCATCATCAACGCACAGGACAGGATAAGCGGCCTCTTCCGTCACGGCTCATCAGCTCGGCAC
CGCCCCAGCCCACTACGACCGATGGTAATGCAGACTTCCAACGGCCGCAACGCCCACGCATGGCACCTCCGAGCC
GCGCTCCCGGCCCGAGAACACCAAGACATCTGGCGCAAGGCAAGCGTAGAGAACTCATGGCAACTCTGGCACGAG
CTCGGCCACCAACGGCAGCACATCTACACCTGGAGCTGGCCGCAGGTACAGGAATCGACCGTCAACATCTACGCG
CTGGCCAGCCGAAGGATGTGGCCGCAGAGAGCGACGGAGCACGGCTCGAGCAGAGAATGGGATGAGGCCAGACGA
TACCTCGCCGAGCGAACCGTCGACTTCGACCACGCAGATCACTTCGTTCAACTGGCCATGTTCGACCAACTCCGC
CAAGTCTTTGGCGACGATTTCTACCATCAGCTTCACGCCCTCTCCCGCCAATCGCCGACCCAGCGCGGGCCCAAA
GAGAAGAAGAACTTCTTCATGACGCGCGCCTCTCTCGTCGCCCGGCAGGATCTGAGCGGCTTTTTCGAGAAATGG
GGCATGGAGCCGGACGAGGAGACCTTGTCGTGGATGAGGGTGCTGCCGGAGCCGCGGTGGGATTATACGCTTACG
CCTGCGTTTGTGCCCGTTTCTGTCAAACAGCTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail