Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01964
Gene name
Locationscaffold_02:2232020..2234536
Strand-
Gene length (bp)2516
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 1.6E-164 59 693
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 4.5E-25 724 784

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0044237 cellular metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0009987 cellular process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0005488 binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0005515 protein binding No
GO:1901575 organic substance catabolic process No
GO:0008150 biological_process No
GO:0006508 proteolysis No
GO:0019941 modification-dependent protein catabolic process No
GO:0019899 enzyme binding No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6307 0.6439 0.1547 0.0902 0.0984 0.0009 0.0904 0.2298 0.4842 0.0037

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5077
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|2630
Ophiocordyceps camponoti-floridani Ophcf2|01964 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3889
Ophiocordyceps kimflemingae Ophio5|5907
Ophiocordyceps subramaniannii Hirsu2|2928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01964
MSSGRGKLPELPAGHQPATQQPNSGPRKLLVKNLRTTQPSGHEAQLEEHYARIKADMFAAIDAIFAGEQPTVPFE
KLYRGIEDVCRRGGGDHLYNVLTHRTMTHLQTVALPRIKRSAGPSSLDVLRTVLAEWKKWNAQAKLIRSTFSYLD
RTFVLKRSMLSINDGLIAAFRTLIVFPPKGDAASSLGSQVVDGICQSIEYDRSGDSRLDDILLKDSVRMLHMLSV
YVTHFEPMFLRKSADYFADCGEQWSASGLKQHISACEKLLRNEEYRCLAYNLESTTAKQLMNVAHDILIDRYSEK
LLHSDSLSQLLSNRDVKSVKGLYDLLRMSGIQAKLKSPWCNYIRATGAAIIADRERGDDMVMRLLDLRRTLDLMI
RDALDRDDELLWGMREAFGNFMNDRDTAACWDTGTSKIGEMTAKHMDMLLRGGLKALPKQLMSDLKDRATAEREG
QSASADEDAELDRQLDQALELFRFIEGKDTFEAFYKKDLARRLLMGRSASQDAERNMLTRLRGECGSNFTHNLEQ
MFKDQELAKDEMDSYKQWSDGAGVKVDLHVMVLSAAAWPTYGDVRLNLPDEVATQMERFDGHYRNKHTGRVLTWK
HSLAHCSLKAALPRGAKELLVSASQAVTLMVFNAVPDDGFLTYDQLSTATGLQGDELDRTLQSLACGKARVLAKH
PRGRDVRPTDTFTLNRAFTDAKYRVKINQIQLRETKEENQATHESIIQDRRFETQAAIVRIMKSRKSMGHAELVA
EVINLTKKRGSVEPAAIKKEIESLIDKEYIERTDGGYAYIS*
Coding >Ophcf2|01964
ATGTCCAGCGGTCGGGGTAAGCTCCCAGAGCTGCCGGCGGGGCATCAGCCTGCGACGCAGCAGCCTAATAGCGGC
CCTCGCAAGCTGTTGGTGAAGAACCTCAGGACGACACAGCCAAGCGGTCATGAAGCTCAGCTGGAAGAGCATTAT
GCCCGTATAAAGGCCGATATGTTCGCCGCCATCGATGCCATCTTCGCAGGCGAGCAGCCGACCGTACCGTTCGAG
AAACTGTACAGGGGCATCGAGGACGTCTGTCGAAGAGGCGGCGGCGACCACTTGTACAACGTTCTGACACATCGA
ACCATGACCCATCTCCAAACGGTGGCCCTACCCAGGATCAAGCGCTCTGCTGGACCATCGAGCCTTGACGTCTTG
AGGACCGTTTTGGCCGAGTGGAAGAAATGGAATGCCCAGGCTAAACTTATCCGCTCGACCTTTTCCTATCTCGAT
CGAACCTTTGTCCTTAAACGTTCGATGCTTTCAATCAACGACGGTCTTATTGCCGCGTTTCGAACTTTGATCGTC
TTTCCTCCCAAGGGAGACGCGGCCTCTTCACTGGGCTCGCAGGTCGTCGACGGCATCTGCCAGTCCATCGAATAT
GATCGCAGTGGCGACTCGCGTCTCGACGACATCCTACTCAAGGACTCGGTGCGCATGCTCCACATGCTGAGCGTC
TACGTCACGCACTTTGAACCCATGTTCCTCCGCAAGTCGGCCGATTACTTCGCCGACTGTGGCGAACAGTGGAGC
GCGTCAGGGCTTAAGCAGCACATCTCGGCCTGCGAGAAGCTCTTGCGCAACGAGGAATATCGCTGCCTGGCCTAT
AACCTGGAGAGCACGACGGCCAAGCAGCTGATGAACGTTGCGCATGACATCCTGATCGACCGCTACTCGGAGAAG
CTCCTGCATAGCGATAGCCTCTCACAGCTCCTGTCCAACAGGGACGTCAAGTCGGTCAAGGGGCTGTATGACCTG
CTGAGAATGTCGGGCATCCAAGCCAAGCTCAAGTCTCCGTGGTGCAACTATATCCGAGCCACGGGTGCGGCCATC
ATTGCCGATCGGGAGCGAGGTGACGACATGGTGATGCGCTTGCTCGACCTGAGGCGAACGCTCGACCTCATGATC
CGCGACGCTCTCGACAGAGACGACGAGCTGCTCTGGGGCATGCGGGAAGCCTTTGGCAACTTCATGAACGACCGC
GATACGGCAGCATGCTGGGACACGGGCACGTCCAAGATTGGCGAGATGACAGCAAAGCATATGGACATGTTGCTC
CGCGGCGGTCTCAAGGCGTTGCCCAAGCAGCTCATGTCGGACCTCAAGGACCGGGCCACGGCCGAGAGGGAGGGA
CAGTCGGCCAGCGCCGACGAGGACGCCGAGCTGGACCGGCAGCTGGACCAGGCCCTCGAGCTCTTTCGTTTCATC
GAGGGCAAGGACACCTTTGAGGCCTTTTACAAAAAAGACCTGGCGCGACGGCTGCTCATGGGCCGCAGTGCCAGC
CAGGATGCCGAGCGCAACATGCTTACGCGGCTTCGGGGCGAGTGCGGCTCCAACTTTACACACAACCTGGAGCAG
ATGTTCAAGGACCAGGAGCTGGCCAAGGACGAGATGGATTCGTACAAGCAGTGGAGCGATGGAGCAGGTGTCAAG
GTCGATCTGCACGTCATGGTGCTCTCGGCAGCAGCCTGGCCGACGTATGGCGACGTGCGGCTGAATCTGCCCGAC
GAGGTGGCCACCCAGATGGAGCGCTTCGATGGCCACTACAGGAACAAGCACACGGGTCGCGTGCTGACGTGGAAG
CACTCGCTGGCCCACTGCTCGCTCAAGGCTGCCTTGCCGCGTGGCGCCAAGGAGCTGCTCGTGTCGGCGTCGCAG
GCCGTCACTCTCATGGTCTTCAACGCGGTGCCGGACGACGGCTTCTTGACGTACGACCAGCTATCGACGGCCACG
GGCCTCCAGGGCGACGAACTGGACCGGACACTCCAGTCGCTGGCCTGCGGCAAGGCGCGCGTTCTGGCCAAGCAC
CCCAGGGGACGCGACGTGAGGCCGACCGACACCTTTACTCTCAACAGGGCCTTTACCGACGCAAAGTACCGCGTC
AAGATTAACCAGATCCAGCTGAGGGAGACCAAGGAGGAGAATCAGGCGACGCACGAAAGCATCATTCAGGACAGG
CGCTTCGAGACGCAGGCCGCCATTGTGCGCATCATGAAGAGCCGCAAGTCCATGGGACACGCCGAACTGGTGGCC
GAGGTTATCAACCTGACCAAGAAACGGGGAAGCGTCGAACCAGCAGCCATAAAGAAGGAGATCGAGAGTCTGATC
GACAAGGAATATATTGAGCGAACAGACGGCGGATACGCGTACATATCTTAA
Transcript >Ophcf2|01964
ATGTCCAGCGGTCGGGGTAAGCTCCCAGAGCTGCCGGCGGGGCATCAGCCTGCGACGCAGCAGCCTAATAGCGGC
CCTCGCAAGCTGTTGGTGAAGAACCTCAGGACGACACAGCCAAGCGGTCATGAAGCTCAGCTGGAAGAGCATTAT
GCCCGTATAAAGGCCGATATGTTCGCCGCCATCGATGCCATCTTCGCAGGCGAGCAGCCGACCGTACCGTTCGAG
AAACTGTACAGGGGCATCGAGGACGTCTGTCGAAGAGGCGGCGGCGACCACTTGTACAACGTTCTGACACATCGA
ACCATGACCCATCTCCAAACGGTGGCCCTACCCAGGATCAAGCGCTCTGCTGGACCATCGAGCCTTGACGTCTTG
AGGACCGTTTTGGCCGAGTGGAAGAAATGGAATGCCCAGGCTAAACTTATCCGCTCGACCTTTTCCTATCTCGAT
CGAACCTTTGTCCTTAAACGTTCGATGCTTTCAATCAACGACGGTCTTATTGCCGCGTTTCGAACTTTGATCGTC
TTTCCTCCCAAGGGAGACGCGGCCTCTTCACTGGGCTCGCAGGTCGTCGACGGCATCTGCCAGTCCATCGAATAT
GATCGCAGTGGCGACTCGCGTCTCGACGACATCCTACTCAAGGACTCGGTGCGCATGCTCCACATGCTGAGCGTC
TACGTCACGCACTTTGAACCCATGTTCCTCCGCAAGTCGGCCGATTACTTCGCCGACTGTGGCGAACAGTGGAGC
GCGTCAGGGCTTAAGCAGCACATCTCGGCCTGCGAGAAGCTCTTGCGCAACGAGGAATATCGCTGCCTGGCCTAT
AACCTGGAGAGCACGACGGCCAAGCAGCTGATGAACGTTGCGCATGACATCCTGATCGACCGCTACTCGGAGAAG
CTCCTGCATAGCGATAGCCTCTCACAGCTCCTGTCCAACAGGGACGTCAAGTCGGTCAAGGGGCTGTATGACCTG
CTGAGAATGTCGGGCATCCAAGCCAAGCTCAAGTCTCCGTGGTGCAACTATATCCGAGCCACGGGTGCGGCCATC
ATTGCCGATCGGGAGCGAGGTGACGACATGGTGATGCGCTTGCTCGACCTGAGGCGAACGCTCGACCTCATGATC
CGCGACGCTCTCGACAGAGACGACGAGCTGCTCTGGGGCATGCGGGAAGCCTTTGGCAACTTCATGAACGACCGC
GATACGGCAGCATGCTGGGACACGGGCACGTCCAAGATTGGCGAGATGACAGCAAAGCATATGGACATGTTGCTC
CGCGGCGGTCTCAAGGCGTTGCCCAAGCAGCTCATGTCGGACCTCAAGGACCGGGCCACGGCCGAGAGGGAGGGA
CAGTCGGCCAGCGCCGACGAGGACGCCGAGCTGGACCGGCAGCTGGACCAGGCCCTCGAGCTCTTTCGTTTCATC
GAGGGCAAGGACACCTTTGAGGCCTTTTACAAAAAAGACCTGGCGCGACGGCTGCTCATGGGCCGCAGTGCCAGC
CAGGATGCCGAGCGCAACATGCTTACGCGGCTTCGGGGCGAGTGCGGCTCCAACTTTACACACAACCTGGAGCAG
ATGTTCAAGGACCAGGAGCTGGCCAAGGACGAGATGGATTCGTACAAGCAGTGGAGCGATGGAGCAGGTGTCAAG
GTCGATCTGCACGTCATGGTGCTCTCGGCAGCAGCCTGGCCGACGTATGGCGACGTGCGGCTGAATCTGCCCGAC
GAGGTGGCCACCCAGATGGAGCGCTTCGATGGCCACTACAGGAACAAGCACACGGGTCGCGTGCTGACGTGGAAG
CACTCGCTGGCCCACTGCTCGCTCAAGGCTGCCTTGCCGCGTGGCGCCAAGGAGCTGCTCGTGTCGGCGTCGCAG
GCCGTCACTCTCATGGTCTTCAACGCGGTGCCGGACGACGGCTTCTTGACGTACGACCAGCTATCGACGGCCACG
GGCCTCCAGGGCGACGAACTGGACCGGACACTCCAGTCGCTGGCCTGCGGCAAGGCGCGCGTTCTGGCCAAGCAC
CCCAGGGGACGCGACGTGAGGCCGACCGACACCTTTACTCTCAACAGGGCCTTTACCGACGCAAAGTACCGCGTC
AAGATTAACCAGATCCAGCTGAGGGAGACCAAGGAGGAGAATCAGGCGACGCACGAAAGCATCATTCAGGACAGG
CGCTTCGAGACGCAGGCCGCCATTGTGCGCATCATGAAGAGCCGCAAGTCCATGGGACACGCCGAACTGGTGGCC
GAGGTTATCAACCTGACCAAGAAACGGGGAAGCGTCGAACCAGCAGCCATAAAGAAGGAGATCGAGAGTCTGATC
GACAAGGAATATATTGAGCGAACAGACGGCGGATACGCGTACATATCTTAA
Gene >Ophcf2|01964
ATGTCCAGCGGTCGGGGTAAGCTCCCAGAGCTGCCGGCGGGGCATCAGCCTGCGACGCAGCAGCCTAATAGCGGC
CCTCGCAAGCTGTTGGTGAAGAACCTCAGGACGACACAGCCAAGCGGTCATGAAGCTCAGCTGGAAGAGCATTAT
GCCCGTATAAAGGCCGATATGTTCGCCGCCATCGATGCCATCTTCGCAGGCGAGCAGCCGACCGTACCGTTCGAG
AAACTGTACAGGGGCATCGAGGACGTCTGTCGAAGAGGCGGCGGCGACCACTTGTACAACGTTCTGACACATCGA
ACCATGACCCATCTCCAAACGGTGGCCCTACCCAGGATCAAGCGCTCTGCTGGACCATCGAGCCTTGACGTCTTG
AGGACCGTTTTGGCCGAGTGGAAGAAATGGAATGCCCAGGCTGTGAGCTCTCCAGACCCCTTCCAGAGGGGCCTT
GGCTCACCTCTCTCATCTCTCGGCAGAAACTTATCCGCTCGACCTTTTCCTATCTCGATCGAACCTTTGTCCTTA
AACGTTCGATGCTTTCAATCAACGACGGTCTTATTGCCGCGTTTCGAACTTTGATCGTCTTTCCTCCCAAGGGAG
ACGCGGCCTCTTCACTGGGCTCGCAGGTCGTCGACGGCATCTGCCAGTCCATCGAATATGATCGCAGTGGCGACT
CGCGTCTCGACGACATCCTACTCAAGGACTCGGTGCGCATGCTCCACATGCTGAGCGTCTACGTCACGCACTTTG
AACCCATGTTCCTCCGCAAGTCGGCCGATTACTTCGCCGACTGTGGCGAACAGTGGAGCGCGTCAGGGCTTAAGC
AGCACATCTCGGCCTGCGAGAAGCTCTTGCGCAACGAGGAATATCGCTGCCTGGCCTATAACCTGGAGAGCACGA
CGGCCAAGCAGCTGATGAACGTTGCGCATGACATCCTGATCGACCGCTACTCGGAGAAGCTCCTGCATAGCGATA
GCCTCTCACAGCTCCTGTCCAACAGGGACGTCAAGTCGGTCAAGGGGCTGTATGACCTGCTGAGAATGTCGGGCA
TCCAAGCCAAGCTCAAGTCTCCGTGGTGCAACTATATCCGAGCCACGGGTGCGGCCATCATTGCCGATCGGGAGC
GAGGTGACGACATGGTGATGCGCTTGCTCGACCTGAGGCGAACGCTCGACCTCATGATCCGCGACGCTCTCGACA
GAGACGACGAGCTGCTCTGGGGCATGCGGGAAGCCTTTGGCAACTTCATGAACGACCGCGATACGGCAGCATGCT
GGGACACGGGCACGTCCAAGATTGGCGAGATGACAGCAAAGCATATGGACATGTTGCTCCGCGGCGGTCTCAAGG
CGTTGCCCAAGCAGCTCATGTCGGACCTCAAGGACCGGGCCACGGCCGAGAGGGAGGGACAGTCGGCCAGCGCCG
ACGAGGACGCCGAGCTGGACCGGCAGCTGGACCAGGCCCTCGAGCTCTTTCGTTTCATCGAGGGCAAGGACACCT
TTGAGGCCTTTTACAAAAAAGACCTGGCGCGACGGCTGCTCATGGGCCGCAGTGCCAGCCAGGATGCCGAGCGCA
ACATGCTTACGCGGCTTCGGGGCGAGTGCGGCTCCAACTTTACACACAACCTGGAGCAGATGTTCAAGGACCAGG
AGCTGGCCAAGGACGAGATGGATTCGTACAAGCAGTGGAGCGATGGAGCAGGTGTCAAGGTCGATCTGCACGTCA
TGGTGCTCTCGGCAGCAGCCTGGCCGACGTATGGCGACGTGCGGCTGAATCTGCCCGACGAGGTGGCCACCCAGA
TGGAGCGCTTCGATGGCCACTACAGGAACAAGCACACGGGTCGCGTGCTGACGTGGAAGCACTCGCTGGCCCACT
GCTCGCTCAAGGCTGCCTTGCCGCGTGGCGCCAAGGAGCTGCTCGTGTCGGCGTCGCAGGCCGTCACTCTCATGG
TCTTCAACGCGGTGCCGGACGACGGCTTCTTGACGTACGACCAGCTATCGACGGCCACGGGCCTCCAGGGCGACG
AACTGGACCGGACACTCCAGTCGCTGGCCTGCGGCAAGGCGCGCGTTCTGGCCAAGCACCCCAGGGGACGCGACG
TGAGGCCGACCGACACCTTTACTCTCAACAGGGCCTTTACCGACGCAAAGTACCGCGTCAAGATTAACCAGATCC
AGCTGAGGGAGACCAAGGAGGAGAATCAGGCGACGCACGAAAGCATCATTCAGGACAGGCGCTTCGAGACGCAGG
CCGCCATTGTGCGCATCATGAAGAGCCGCAAGTCCATGGGACACGCCGAACTGGTGGCCGAGGTTATCAACCTGA
CCAAGAAACGGGGAAGCGTCGAACCAGCAGCCATAAAGAAGGAGATCGAGAGGTGAGCAGTCATGTCCCCCTTTT
TCCACACCGCAATTTATCATTCTTGTACGACAGAGCTGACGGGCTCATGTTGCTGCAGTCTGATCGACAAGGAAT
ATATTGAGCGAACAGACGGCGGATACGCGTACATATCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail