Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01958
Gene name
Locationscaffold_02:2208095..2210312
Strand-
Gene length (bp)2217
Transcript length (bp)2217
Coding sequence length (bp)2217
Protein length (aa) 739

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08733 PalH PalH/RIM21 1.6E-105 57 374

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 215 234 19
3 254 276 22
4 296 318 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.51 18.39 46.62
Alive In ants, during behavior modification 28.80 15.90 41.70
Dead In ants, recently dead 32.10 18.09 46.12

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.587162 no
Alive Dead 0.569534 no
Dead Fungus 0.961244 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01958
METLTYPSTAATLCTTTSLVPAKGFLAMTAGPSSQTVVYEVPCPTLNPVVAVVAAEQRPDTHDSSSDARISVTDP
FYASTFPICYALAAATVTAYMLLIMLFVTPRSFLDGGVVYLGRRRGFIHSSSGGENIGGRPWLQKVATLTVAISL
TIATHHTFEIAQRQYLWGAQNAGVLQTSVMGRIELRAIRLISDTFLWLAQAQTLIRLFPRHREKVIIKWAAFALI
TLNLIFTALNSFNEKGFTAPVGGSFRHPIPALSYLFQLLLGVLYAAWVIYYSLMKKRYAFYHPLMKNMPLLAIIS
LTSILIPVVFFIVDFIRVEFTSWGDYVRWVGAAAASVIVWEWVERIEALEREEKKDGILGREVFDGDDTLEVNAS
ESPWLRHRKMGGGGNDDDEYGDCGGGGDYYYHDQDHRRHRHHHHHHHHHLHGHGHHHDRRGAESGSGNGQRHQWP
LRTNGWPGVSAMTGRQQTQAHDAPLRTMSDMLRPPLWPSRPAPTVTPVSRTDTPSAASTVYAVRYQGTSDTTSRT
PDPPASTPDPQPLAQADDDYAPPAMEDLAATAAAATSGRPRRWRALATLRASSPAPSLGDKEKEAEEDVHRLATR
DMVVESTDDSRDEASRWDIRSRLELFAANQAEKLREKLRPSTETESLPVTVIPAPPRQGTALRRMLEEETTSGGA
AATVDRGDSWTEDEAPTNPPLWPGVRREWVLGFEETESAVDDSLSEAETASMEDEDEDELSEV*
Coding >Ophcf2|01958
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACTGCCGGTCCGTCCTCACAAACCGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACAGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTATGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCGTCACTCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGTCGCGGCTTCATCCACAGC
TCCTCGGGCGGCGAGAACATCGGTGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCATCTCCCTG
ACCATCGCCACCCATCACACTTTCGAGATCGCCCAGCGTCAGTACCTATGGGGCGCCCAGAACGCCGGCGTCCTG
CAGACCTCCGTCATGGGCCGCATCGAGCTCCGCGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTCGCTCAG
GCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTCATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCAACCTCATCTTCACCGCCCTCAACAGCTTCAATGAAAAAGGCTTCACCGCCCCCGTCGGCGGCAGCTTC
AGACACCCCATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGTTACGCCTTTTATCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATTCCCGTCGTCTTCTTCATCGTCGACTTCATCAGGGTCGAGTTCACCAGCTGGGGAGAC
TACGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGTGACGACACGCTCGAGGTCAACGCGTCC
GAGTCCCCCTGGCTGCGACACCGCAAGATGGGGGGTGGTGGTAACGACGACGACGAATACGGCGACTGCGGCGGA
GGCGGCGACTACTACTACCACGATCAAGACCACCGTCGGCACCGCCACCATCATCACCACCACCACCACCACCTT
CATGGCCATGGCCACCACCATGACCGCCGCGGTGCCGAGAGCGGCAGCGGCAACGGCCAGCGCCACCAGTGGCCC
CTGCGCACCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAGGCGCACGACGCGCCGCTG
CGGACCATGAGCGACATGCTACGGCCGCCGCTGTGGCCTTCGCGACCGGCGCCGACGGTGACGCCCGTTAGCCGG
ACGGACACGCCGAGCGCTGCCAGCACCGTGTACGCGGTCCGGTACCAAGGCACGTCGGACACGACGTCTCGGACG
CCGGATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATTACGCCCCACCGGCCATG
GAGGACTTGGCGGCGACGGCGGCGGCGGCTACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTGCGACGCTGAGG
GCGAGCAGCCCGGCGCCGTCGTTGGGCGACAAGGAGAAGGAGGCGGAGGAAGATGTGCATCGGCTGGCGACGAGG
GATATGGTGGTGGAGTCGACCGACGACAGCAGAGACGAGGCGAGCCGTTGGGACATACGGTCACGTCTGGAGTTG
TTCGCGGCCAACCAGGCGGAGAAGCTGCGGGAGAAACTACGGCCGTCGACGGAAACGGAGAGCCTGCCGGTGACG
GTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGATGCTGGAGGAGGAGACGACGTCGGGAGGGGCG
GCGGCGACGGTTGACAGGGGCGACAGCTGGACGGAGGACGAGGCGCCGACGAACCCTCCGCTGTGGCCCGGAGTC
CGGCGCGAGTGGGTGCTCGGATTCGAGGAGACGGAGTCTGCGGTGGACGACTCGCTCTCGGAGGCGGAGACGGCG
TCGATGGAAGACGAGGACGAGGACGAGCTGTCGGAGGTGTGA
Transcript >Ophcf2|01958
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACTGCCGGTCCGTCCTCACAAACCGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACAGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTATGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCGTCACTCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGTCGCGGCTTCATCCACAGC
TCCTCGGGCGGCGAGAACATCGGTGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCATCTCCCTG
ACCATCGCCACCCATCACACTTTCGAGATCGCCCAGCGTCAGTACCTATGGGGCGCCCAGAACGCCGGCGTCCTG
CAGACCTCCGTCATGGGCCGCATCGAGCTCCGCGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTCGCTCAG
GCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTCATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCAACCTCATCTTCACCGCCCTCAACAGCTTCAATGAAAAAGGCTTCACCGCCCCCGTCGGCGGCAGCTTC
AGACACCCCATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGTTACGCCTTTTATCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATTCCCGTCGTCTTCTTCATCGTCGACTTCATCAGGGTCGAGTTCACCAGCTGGGGAGAC
TACGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGTGACGACACGCTCGAGGTCAACGCGTCC
GAGTCCCCCTGGCTGCGACACCGCAAGATGGGGGGTGGTGGTAACGACGACGACGAATACGGCGACTGCGGCGGA
GGCGGCGACTACTACTACCACGATCAAGACCACCGTCGGCACCGCCACCATCATCACCACCACCACCACCACCTT
CATGGCCATGGCCACCACCATGACCGCCGCGGTGCCGAGAGCGGCAGCGGCAACGGCCAGCGCCACCAGTGGCCC
CTGCGCACCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAGGCGCACGACGCGCCGCTG
CGGACCATGAGCGACATGCTACGGCCGCCGCTGTGGCCTTCGCGACCGGCGCCGACGGTGACGCCCGTTAGCCGG
ACGGACACGCCGAGCGCTGCCAGCACCGTGTACGCGGTCCGGTACCAAGGCACGTCGGACACGACGTCTCGGACG
CCGGATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATTACGCCCCACCGGCCATG
GAGGACTTGGCGGCGACGGCGGCGGCGGCTACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTGCGACGCTGAGG
GCGAGCAGCCCGGCGCCGTCGTTGGGCGACAAGGAGAAGGAGGCGGAGGAAGATGTGCATCGGCTGGCGACGAGG
GATATGGTGGTGGAGTCGACCGACGACAGCAGAGACGAGGCGAGCCGTTGGGACATACGGTCACGTCTGGAGTTG
TTCGCGGCCAACCAGGCGGAGAAGCTGCGGGAGAAACTACGGCCGTCGACGGAAACGGAGAGCCTGCCGGTGACG
GTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGATGCTGGAGGAGGAGACGACGTCGGGAGGGGCG
GCGGCGACGGTTGACAGGGGCGACAGCTGGACGGAGGACGAGGCGCCGACGAACCCTCCGCTGTGGCCCGGAGTC
CGGCGCGAGTGGGTGCTCGGATTCGAGGAGACGGAGTCTGCGGTGGACGACTCGCTCTCGGAGGCGGAGACGGCG
TCGATGGAAGACGAGGACGAGGACGAGCTGTCGGAGGTGTGA
Gene >Ophcf2|01958
ATGGAGACTTTGACCTATCCCTCGACGGCGGCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCCAAGGGCTTC
TTGGCAATGACTGCCGGTCCGTCCTCACAAACCGTCGTCTACGAGGTGCCCTGTCCGACCTTGAACCCCGTCGTC
GCCGTCGTCGCCGCAGAGCAGAGGCCCGACACCCACGACAGCTCCTCGGACGCCCGCATCTCCGTCACCGACCCC
TTCTATGCTTCCACCTTTCCTATCTGCTACGCCCTCGCCGCCGCCACCGTCACCGCCTACATGCTCCTCATCATG
CTCTTCGTCACTCCGCGCTCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGTCGCGGCTTCATCCACAGC
TCCTCGGGCGGCGAGAACATCGGTGGCCGTCCCTGGCTACAAAAGGTGGCCACCCTCACCGTCGCCATCTCCCTG
ACCATCGCCACCCATCACACTTTCGAGATCGCCCAGCGTCAGTACCTATGGGGCGCCCAGAACGCCGGCGTCCTG
CAGACCTCCGTCATGGGCCGCATCGAGCTCCGCGCCATCCGCCTCATCTCCGACACCTTTCTCTGGCTCGCTCAG
GCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTCATCATCAAGTGGGCCGCCTTTGCCCTCATC
ACGCTCAACCTCATCTTCACCGCCCTCAACAGCTTCAATGAAAAAGGCTTCACCGCCCCCGTCGGCGGCAGCTTC
AGACACCCCATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTCCTCTACGCCGCCTGGGTCATCTAC
TACTCACTCATGAAGAAGCGTTACGCCTTTTATCATCCGCTCATGAAGAACATGCCGCTGCTGGCCATCATCTCC
CTCACGTCCATCCTCATTCCCGTCGTCTTCTTCATCGTCGACTTCATCAGGGTCGAGTTCACCAGCTGGGGAGAC
TACGTGCGCTGGGTCGGCGCCGCGGCCGCCAGCGTCATCGTGTGGGAGTGGGTCGAGCGCATCGAGGCGCTCGAG
CGCGAGGAGAAGAAGGACGGTATCCTCGGCCGCGAGGTGTTTGACGGTGACGACACGCTCGAGGTCAACGCGTCC
GAGTCCCCCTGGCTGCGACACCGCAAGATGGGGGGTGGTGGTAACGACGACGACGAATACGGCGACTGCGGCGGA
GGCGGCGACTACTACTACCACGATCAAGACCACCGTCGGCACCGCCACCATCATCACCACCACCACCACCACCTT
CATGGCCATGGCCACCACCATGACCGCCGCGGTGCCGAGAGCGGCAGCGGCAACGGCCAGCGCCACCAGTGGCCC
CTGCGCACCAACGGCTGGCCCGGGGTGTCGGCCATGACGGGCCGGCAACAGACGCAGGCGCACGACGCGCCGCTG
CGGACCATGAGCGACATGCTACGGCCGCCGCTGTGGCCTTCGCGACCGGCGCCGACGGTGACGCCCGTTAGCCGG
ACGGACACGCCGAGCGCTGCCAGCACCGTGTACGCGGTCCGGTACCAAGGCACGTCGGACACGACGTCTCGGACG
CCGGATCCGCCAGCATCGACGCCGGATCCACAGCCGCTAGCGCAGGCCGACGACGATTACGCCCCACCGGCCATG
GAGGACTTGGCGGCGACGGCGGCGGCGGCTACGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTTGCGACGCTGAGG
GCGAGCAGCCCGGCGCCGTCGTTGGGCGACAAGGAGAAGGAGGCGGAGGAAGATGTGCATCGGCTGGCGACGAGG
GATATGGTGGTGGAGTCGACCGACGACAGCAGAGACGAGGCGAGCCGTTGGGACATACGGTCACGTCTGGAGTTG
TTCGCGGCCAACCAGGCGGAGAAGCTGCGGGAGAAACTACGGCCGTCGACGGAAACGGAGAGCCTGCCGGTGACG
GTGATACCGGCGCCGCCGCGGCAGGGCACGGCGCTTCGTCGGATGCTGGAGGAGGAGACGACGTCGGGAGGGGCG
GCGGCGACGGTTGACAGGGGCGACAGCTGGACGGAGGACGAGGCGCCGACGAACCCTCCGCTGTGGCCCGGAGTC
CGGCGCGAGTGGGTGCTCGGATTCGAGGAGACGGAGTCTGCGGTGGACGACTCGCTCTCGGAGGCGGAGACGGCG
TCGATGGAAGACGAGGACGAGGACGAGCTGTCGGAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail