Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01957
Gene name
Locationscaffold_02:2205740..2207108
Strand-
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 2.5E-34 195 400
PF08390 TRAM1 TRAM1-like protein 5.1E-22 132 192

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 107 124 17
2 157 179 22
3 200 222 22
4 242 264 22
5 280 302 22
6 317 339 22
7 344 361 17
8 376 398 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01957
MTEPFPLLNTSAEQLHHSEVERGGGRAPSRRRSANSGGGVYDGSVVAEDVAEAVVPAMATANSNAAPTTTTTTMT
TTTMTTTKRLSKRRRARGLASRLRQAMMRKTYILPAFIITAALAAYALGPQTNNALAPFIFLSYRVPDSTPRAMY
GKGPADMAFVAFYTIVLSFAREFVMLELLRPLARRARLSRAKQARFMEQMYTAVYFGFLGPLGILVMSRTPVWYF
DTRGMYEGFPHKTHDALAKFYYLFQAAYWAQQAIVLLLGMEKPRKDFKELVGHHIVSLALIGLSYRFHFTYIGIA
VYTTHDISDFFLATSKVLNYIDHPLVGPYFFLFMCVWIYMRHYINLRIIISLFTQFRSIGPFSHKWLPHMYKNSL
SQYVTISLLSSLQALNLFWLFHIVRIAYRFVVHNIAEDDRSDDEDEHKPPPPPPSVDDTPRAVSTALPPSPSPAK
AQRRQ*
Coding >Ophcf2|01957
ATGACGGAGCCTTTCCCCCTGCTCAACACTTCAGCCGAACAGCTTCACCACTCGGAAGTCGAGCGCGGAGGAGGA
CGAGCGCCTTCACGACGACGCAGTGCGAACAGTGGTGGTGGCGTCTACGACGGTTCCGTCGTTGCCGAGGACGTG
GCTGAAGCTGTTGTTCCAGCCATGGCCACGGCCAATTCGAATGCTGCCCCGACGACGACGACGACGACGATGACG
ACGACGACGATGACGACGACGAAGCGTCTCTCCAAGAGGAGACGGGCTCGAGGCCTCGCTTCTCGTCTCCGACAA
GCCATGATGCGAAAGACGTACATCCTCCCAGCCTTCATCATCACAGCCGCATTAGCAGCCTACGCCCTCGGACCC
CAAACAAACAACGCCCTCGCCCCCTTCATCTTCCTCTCCTACCGCGTCCCCGATTCGACCCCGAGAGCAATGTAC
GGCAAAGGTCCCGCCGACATGGCCTTCGTCGCCTTCTACACCATCGTCCTATCCTTCGCCCGCGAATTCGTCATG
CTCGAACTCCTCCGTCCCCTCGCCCGAAGAGCCCGTCTCTCCCGCGCCAAACAAGCCCGCTTCATGGAACAGATG
TACACGGCCGTCTACTTTGGCTTCCTCGGTCCCTTGGGCATCCTCGTCATGAGCAGGACTCCTGTTTGGTATTTC
GATACCAGGGGCATGTACGAGGGTTTCCCCCACAAGACGCACGACGCCCTCGCCAAGTTCTACTACCTCTTCCAA
GCCGCCTACTGGGCCCAACAAGCCATCGTCCTCCTGCTCGGAATGGAGAAGCCCCGCAAGGATTTCAAGGAACTC
GTCGGCCATCACATCGTCAGCCTCGCCCTCATAGGCCTCAGCTACCGCTTCCACTTCACCTACATCGGCATCGCC
GTCTACACCACCCACGACATCAGCGACTTCTTCCTCGCGACCTCAAAGGTCCTCAACTACATCGACCACCCCCTC
GTCGGCCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACATGCGCCACTACATAAACCTGCGCATCATCATC
TCCCTCTTCACCCAGTTCCGCTCCATCGGCCCCTTTTCCCACAAGTGGCTCCCCCACATGTACAAGAACTCCCTC
AGCCAGTACGTCACCATCTCGCTGCTCTCCTCTCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTCCGC
ATCGCCTACCGCTTCGTCGTCCACAACATCGCAGAGGACGACCGCTCAGACGACGAAGACGAACACAAGCCTCCT
CCTCCTCCTCCCTCGGTCGACGACACCCCGCGAGCCGTCTCCACCGCCCTCCCTCCCTCCCCTTCACCGGCAAAG
GCACAGCGGAGACAGTAA
Transcript >Ophcf2|01957
ATGACGGAGCCTTTCCCCCTGCTCAACACTTCAGCCGAACAGCTTCACCACTCGGAAGTCGAGCGCGGAGGAGGA
CGAGCGCCTTCACGACGACGCAGTGCGAACAGTGGTGGTGGCGTCTACGACGGTTCCGTCGTTGCCGAGGACGTG
GCTGAAGCTGTTGTTCCAGCCATGGCCACGGCCAATTCGAATGCTGCCCCGACGACGACGACGACGACGATGACG
ACGACGACGATGACGACGACGAAGCGTCTCTCCAAGAGGAGACGGGCTCGAGGCCTCGCTTCTCGTCTCCGACAA
GCCATGATGCGAAAGACGTACATCCTCCCAGCCTTCATCATCACAGCCGCATTAGCAGCCTACGCCCTCGGACCC
CAAACAAACAACGCCCTCGCCCCCTTCATCTTCCTCTCCTACCGCGTCCCCGATTCGACCCCGAGAGCAATGTAC
GGCAAAGGTCCCGCCGACATGGCCTTCGTCGCCTTCTACACCATCGTCCTATCCTTCGCCCGCGAATTCGTCATG
CTCGAACTCCTCCGTCCCCTCGCCCGAAGAGCCCGTCTCTCCCGCGCCAAACAAGCCCGCTTCATGGAACAGATG
TACACGGCCGTCTACTTTGGCTTCCTCGGTCCCTTGGGCATCCTCGTCATGAGCAGGACTCCTGTTTGGTATTTC
GATACCAGGGGCATGTACGAGGGTTTCCCCCACAAGACGCACGACGCCCTCGCCAAGTTCTACTACCTCTTCCAA
GCCGCCTACTGGGCCCAACAAGCCATCGTCCTCCTGCTCGGAATGGAGAAGCCCCGCAAGGATTTCAAGGAACTC
GTCGGCCATCACATCGTCAGCCTCGCCCTCATAGGCCTCAGCTACCGCTTCCACTTCACCTACATCGGCATCGCC
GTCTACACCACCCACGACATCAGCGACTTCTTCCTCGCGACCTCAAAGGTCCTCAACTACATCGACCACCCCCTC
GTCGGCCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACATGCGCCACTACATAAACCTGCGCATCATCATC
TCCCTCTTCACCCAGTTCCGCTCCATCGGCCCCTTTTCCCACAAGTGGCTCCCCCACATGTACAAGAACTCCCTC
AGCCAGTACGTCACCATCTCGCTGCTCTCCTCTCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTCCGC
ATCGCCTACCGCTTCGTCGTCCACAACATCGCAGAGGACGACCGCTCAGACGACGAAGACGAACACAAGCCTCCT
CCTCCTCCTCCCTCGGTCGACGACACCCCGCGAGCCGTCTCCACCGCCCTCCCTCCCTCCCCTTCACCGGCAAAG
GCACAGCGGAGACAGTAA
Gene >Ophcf2|01957
ATGACGGAGCCTTTCCCCCTGCTCAACACTTCAGCCGAACAGCTTCACCACTCGGAAGTCGAGCGCGGAGGAGGA
CGAGCGCCTTCACGACGACGCAGTGCGAACAGTGGTGGTGGCGTCTACGACGGTTCCGTCGTTGCCGAGGACGTG
GCTGAAGCTGTTGTTCCAGCCATGGCCACGGCCAATTCGAATGCTGCCCCGACGACGACGACGACGACGATGACG
ACGACGACGATGACGACGACGAAGCGTCTCTCCAAGAGGAGACGGGCTCGAGGCCTCGCTTCTCGTCTCCGACAA
GCCATGATGCGAAAGACGTACATCCTCCCAGCCTTCATCATCACAGCCGCATTAGCAGCCTACGCCCTCGGACCC
CAAACAAACAACGCCCTCGCCCCCTTCATCTTCCTCTCCTACCGCGTCCCCGATTCGACCCCGAGAGCAATGTAC
GGCAAAGGTCCCGCCGACATGGCCTTCGTCGCCTTCTACACCATCGTCCTATCCTTCGCCCGCGAATTCGTCATG
CTCGAACTCCTCCGTCCCCTCGCCCGAAGAGCCCGTCTCTCCCGCGCCAAACAAGCCCGCTTCATGGAACAGATG
TACACGGCCGTCTACTTTGGCTTCCTCGGTCCCTTGGGCATCCTCGTCATGAGCAGGACTCCTGTTTGGTATTTC
GATACCAGGGGCATGTACGAGGGTTTCCCCCACAAGACGCACGACGCCCTCGCCAAGTTCTACTACCTCTTCCAA
GCCGCCTACTGGGCCCAACAAGCCATCGTCCTCCTGCTCGGAATGGAGAAGCCCCGCAAGGATTTCAAGGAACTC
GTCGGCCATCACATCGTCAGCCTCGCCCTCATAGGCCTCAGCTACCGCTTCCACTTCACCTACATCGGCATCGCC
GTCTACACCACCCACGACATCAGCGACTTCTTCCTCGCGACCTCAAAGGTCCTCAACTACATCGACCACCCCCTC
GTCGGCCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACATGCGCCACTACATAAACCTGCGCATCATCATC
TCCCTCTTCACCCAGTTCCGCTCCATCGGCCCCTTTTCCCACAAGTGGCTCCCCCACATGTACAAGAACTCCCTC
AGCCAGTACGTCACCATCTCGCTGCTCTCCTCTCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTCCGC
ATCGCCTACCGCTTCGTCGTCCACAACATCGCAGAGGACGACCGCTCAGACGACGAAGACGAACACAAGCCTCCT
CCTCCTCCTCCCTCGGTCGACGACACCCCGCGAGCCGTCTCCACCGCCCTCCCTCCCTCCCCTTCACCGGCAAAG
GCACAGCGGAGACAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail