Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01956
Gene name
Locationscaffold_02:2201098..2204374
Strand+
Gene length (bp)3276
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 3.1E-31 711 860
PF00664 ABC_membrane ABC transporter transmembrane region 1.5E-28 366 649

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0140359 ABC-type transporter activity Yes
GO:1901363 heterocyclic compound binding No
GO:0005215 transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0031224 intrinsic component of membrane No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0043168 anion binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0051179 localization No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 102 124 22
3 139 161 22
4 173 195 22
5 219 241 22
6 608 627 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 119.18 58.46 179.90
Alive In ants, during behavior modification 14.37 7.61 21.13
Dead In ants, recently dead 27.21 15.44 38.98

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01956
MEAEDESPPSRRGPDHGHPETLVDLILREMQYIYALVLLVTFLTGAAWYSVYNAKRQEVLAQPKAKGPGGKPLPV
TKSKKRDSGQRKLGPSFGPAAKIVFRYLAFVVFSTYVASGVALFDHAFWHENPYKWSKEGLPWAGEWTVVHVMGS
TFFYLYLLFSLFDWRKGPNVVHLFVWTLGLAGESVMFAATFVAAAQCHFMPRLASGSDTCIDYWAKVDLVLYFLR
FLHLLALISLFCLAWVCKVRQPGARIEEGRVTESTPLLNGSSRDAGTDGLYERNPRPQSERRRRQSTSSRDDADD
TVDGGNNNPNNARPAVKGSSGKDETAAFYRPDKLPHRTWWEYLRGYSLFFPYLWPRDTLVLQLHVLVCFALVILQ
RLVNMAVPYQIGRVVNKLVAATKDVSNGLPLTKENFPLADFAILGALWILQGQSGLLGSLRSLLWIPVSQYSYRG
LTTAAFNHVHSLSLDFHLSKRTGEVLSALNKGSAINQFLEQVTFQVVPMLFDLFLSISVFYFQYGPLYAEINLVD
TCWYLYMTIKMASTRADQRREMTNADREEEAVKNDSISSYETVKYFNAEEYEANRYRDKVAVFQAAEAKVQMGMV
MMNICQTLVFNLGRIVAAVVCGWQVAVGMRSTGDWFMVVSYLTQLQGPLNFFGTFYRTVQQAMISGERLLELFKI
DPGVVDAPHAVPLQDFRGHIRWKNVSFAYDRRRPALRNVSFECLPGTTTAFIGESGGGKSTLFRHMFRYYDCHEG
SIELDGKNVRDLTISSVRSHIGVVPQDTSLFNESLMYNLKYANPEATTAQVHAACAAASIHDRIMSFPDQYETQV
GERGLRLSGGEKQRVAIARTILKNPRIIMLDEATSALDTHTEQEIQNNVWEVGQGRTLLVIAHRLSTITHADQII
VLHAGEIVERGTHKELLAARGRYASMWEKQIRAERALDKAREATMKANKALKRANMNANAEVAEDQAEDYHALGS
SGILTDNDTSKSKADDGECSSSSSSSSSPSSSSSDAGSSHDADGPARRQSNAKARR*
Coding >Ophcf2|01956
ATGGAGGCCGAGGACGAGAGCCCGCCCTCAAGACGAGGTCCTGACCATGGCCACCCCGAAACATTGGTAGACCTG
ATCCTTCGCGAGATGCAGTACATCTACGCCCTTGTGCTCCTCGTCACCTTCCTCACCGGTGCCGCCTGGTATAGC
GTCTACAACGCCAAGCGGCAAGAGGTTCTTGCTCAACCCAAGGCCAAAGGCCCCGGCGGAAAACCGCTGCCGGTG
ACCAAGTCTAAGAAGCGCGACAGCGGACAGCGCAAACTCGGCCCCAGTTTCGGACCGGCTGCAAAAATCGTCTTT
CGCTACCTGGCCTTCGTCGTCTTCTCGACCTACGTCGCCAGCGGCGTCGCCCTGTTCGACCATGCCTTTTGGCAC
GAGAATCCCTACAAATGGTCCAAAGAAGGGCTTCCCTGGGCTGGAGAATGGACTGTGGTTCACGTCATGGGTTCC
ACTTTCTTCTATCTATACCTACTCTTCTCCCTCTTCGACTGGCGCAAAGGCCCCAATGTCGTTCACCTGTTCGTC
TGGACCCTCGGCCTGGCCGGTGAATCCGTCATGTTCGCCGCCACCTTCGTCGCCGCCGCGCAGTGCCACTTTATG
CCCCGCCTCGCTTCCGGGTCAGACACCTGCATCGACTACTGGGCCAAGGTCGACCTTGTGCTCTATTTCCTTCGC
TTCCTGCACCTGTTGGCCCTCATCAGCCTCTTTTGCTTGGCGTGGGTCTGCAAGGTCCGCCAACCCGGAGCCCGG
ATCGAGGAAGGTCGTGTGACCGAGTCGACGCCACTGCTCAACGGCTCCTCCCGCGATGCCGGTACAGATGGCCTC
TACGAGCGCAACCCGCGTCCCCAATCGGAGCGTCGGCGCAGGCAGTCGACGTCGAGCCGGGACGACGCCGACGAC
ACCGTCGACGGTGGGAACAACAATCCCAACAACGCCAGGCCGGCCGTCAAGGGCTCTTCCGGAAAGGACGAGACG
GCGGCCTTTTACCGCCCGGACAAGCTCCCCCATCGTACTTGGTGGGAGTATCTGAGGGGATACTCCCTCTTCTTC
CCTTACCTGTGGCCCAGGGATACCCTCGTGCTGCAGTTGCACGTCCTCGTCTGCTTCGCCCTCGTCATTCTGCAG
AGACTGGTCAACATGGCGGTCCCCTATCAGATCGGTCGTGTCGTCAACAAGCTCGTTGCGGCCACCAAGGATGTG
AGCAACGGACTGCCGCTCACCAAGGAAAACTTTCCCCTGGCCGATTTCGCCATCCTCGGCGCGCTCTGGATCCTC
CAGGGCCAGTCGGGTCTGCTGGGCTCGCTGAGGTCGCTGCTGTGGATTCCCGTCTCGCAGTATTCGTACCGGGGC
TTGACCACGGCCGCCTTCAACCACGTGCACTCGCTCAGCCTCGACTTCCACCTGTCGAAGCGCACGGGCGAGGTG
CTGTCGGCGCTCAACAAGGGCTCCGCCATCAACCAGTTTCTCGAGCAGGTGACGTTCCAGGTCGTGCCCATGCTC
TTCGACCTGTTTCTCTCCATCTCCGTCTTTTACTTCCAGTACGGCCCCCTCTATGCCGAGATCAATCTCGTCGAC
ACGTGCTGGTACCTTTACATGACGATCAAGATGGCCTCGACGCGGGCCGACCAGCGTCGCGAGATGACGAACGCC
GACCGCGAGGAGGAGGCGGTCAAGAATGACTCCATCTCGAGCTACGAGACGGTCAAGTACTTCAACGCCGAGGAG
TACGAGGCCAACCGATACCGCGACAAGGTGGCCGTCTTCCAGGCCGCCGAGGCCAAGGTGCAGATGGGCATGGTG
ATGATGAACATCTGCCAGACGCTCGTCTTCAACCTCGGCCGCATCGTGGCCGCCGTCGTGTGCGGCTGGCAGGTG
GCCGTCGGCATGAGGAGCACGGGCGACTGGTTCATGGTGGTTTCGTACCTGACGCAGTTACAGGGTCCTCTCAAC
TTCTTCGGTACCTTTTACCGTACCGTCCAACAGGCCATGATATCGGGCGAGCGCCTGCTGGAGCTCTTCAAGATC
GATCCGGGCGTCGTCGACGCGCCTCACGCGGTCCCTCTCCAAGACTTTCGCGGTCACATACGGTGGAAGAACGTC
AGCTTCGCCTACGATAGGCGGCGGCCGGCCCTGCGCAACGTCAGCTTCGAGTGCTTGCCGGGCACGACGACGGCC
TTTATCGGCGAGTCGGGCGGTGGCAAGTCGACGCTGTTCCGCCACATGTTCCGCTACTACGACTGTCACGAGGGC
AGCATCGAGCTGGACGGCAAGAACGTCAGGGATCTCACCATCAGCTCCGTCCGGAGTCACATTGGCGTCGTCCCG
CAGGACACGAGCCTCTTCAACGAGTCGCTCATGTACAACCTCAAATATGCCAACCCGGAGGCGACGACGGCGCAG
GTACACGCCGCCTGCGCAGCCGCCAGCATCCACGACCGCATCATGTCCTTCCCGGACCAGTACGAGACGCAGGTG
GGAGAGCGGGGGCTGCGTCTGAGCGGCGGCGAGAAGCAGCGCGTCGCCATTGCGCGCACCATTCTCAAGAACCCG
CGCATCATCATGCTGGACGAGGCCACTTCGGCTCTGGACACGCACACGGAACAGGAGATTCAGAACAACGTGTGG
GAGGTGGGCCAGGGACGCACCCTGCTCGTCATCGCCCACCGATTGTCGACGATTACGCACGCTGACCAGATCATC
GTCCTGCACGCCGGAGAGATTGTCGAGCGAGGGACGCATAAGGAGCTCCTCGCCGCTCGCGGACGCTACGCCTCG
ATGTGGGAGAAGCAGATTCGGGCTGAGAGGGCCCTGGATAAAGCGAGAGAGGCAACCATGAAGGCGAACAAGGCA
CTCAAGAGAGCCAACATGAATGCCAACGCTGAAGTGGCGGAAGACCAAGCAGAGGACTATCATGCCCTCGGATCC
TCGGGCATCTTGACGGATAACGACACGTCCAAGAGCAAGGCCGACGACGGAGAATGCTCGAGCTCCTCTTCGTCT
TCGAGCTCGCCCTCGTCGTCATCGTCGGATGCCGGTTCGTCGCACGATGCCGACGGTCCTGCCAGGCGACAGTCG
AACGCCAAGGCGCGGCGGTGA
Transcript >Ophcf2|01956
ATGGAGGCCGAGGACGAGAGCCCGCCCTCAAGACGAGGTCCTGACCATGGCCACCCCGAAACATTGGTAGACCTG
ATCCTTCGCGAGATGCAGTACATCTACGCCCTTGTGCTCCTCGTCACCTTCCTCACCGGTGCCGCCTGGTATAGC
GTCTACAACGCCAAGCGGCAAGAGGTTCTTGCTCAACCCAAGGCCAAAGGCCCCGGCGGAAAACCGCTGCCGGTG
ACCAAGTCTAAGAAGCGCGACAGCGGACAGCGCAAACTCGGCCCCAGTTTCGGACCGGCTGCAAAAATCGTCTTT
CGCTACCTGGCCTTCGTCGTCTTCTCGACCTACGTCGCCAGCGGCGTCGCCCTGTTCGACCATGCCTTTTGGCAC
GAGAATCCCTACAAATGGTCCAAAGAAGGGCTTCCCTGGGCTGGAGAATGGACTGTGGTTCACGTCATGGGTTCC
ACTTTCTTCTATCTATACCTACTCTTCTCCCTCTTCGACTGGCGCAAAGGCCCCAATGTCGTTCACCTGTTCGTC
TGGACCCTCGGCCTGGCCGGTGAATCCGTCATGTTCGCCGCCACCTTCGTCGCCGCCGCGCAGTGCCACTTTATG
CCCCGCCTCGCTTCCGGGTCAGACACCTGCATCGACTACTGGGCCAAGGTCGACCTTGTGCTCTATTTCCTTCGC
TTCCTGCACCTGTTGGCCCTCATCAGCCTCTTTTGCTTGGCGTGGGTCTGCAAGGTCCGCCAACCCGGAGCCCGG
ATCGAGGAAGGTCGTGTGACCGAGTCGACGCCACTGCTCAACGGCTCCTCCCGCGATGCCGGTACAGATGGCCTC
TACGAGCGCAACCCGCGTCCCCAATCGGAGCGTCGGCGCAGGCAGTCGACGTCGAGCCGGGACGACGCCGACGAC
ACCGTCGACGGTGGGAACAACAATCCCAACAACGCCAGGCCGGCCGTCAAGGGCTCTTCCGGAAAGGACGAGACG
GCGGCCTTTTACCGCCCGGACAAGCTCCCCCATCGTACTTGGTGGGAGTATCTGAGGGGATACTCCCTCTTCTTC
CCTTACCTGTGGCCCAGGGATACCCTCGTGCTGCAGTTGCACGTCCTCGTCTGCTTCGCCCTCGTCATTCTGCAG
AGACTGGTCAACATGGCGGTCCCCTATCAGATCGGTCGTGTCGTCAACAAGCTCGTTGCGGCCACCAAGGATGTG
AGCAACGGACTGCCGCTCACCAAGGAAAACTTTCCCCTGGCCGATTTCGCCATCCTCGGCGCGCTCTGGATCCTC
CAGGGCCAGTCGGGTCTGCTGGGCTCGCTGAGGTCGCTGCTGTGGATTCCCGTCTCGCAGTATTCGTACCGGGGC
TTGACCACGGCCGCCTTCAACCACGTGCACTCGCTCAGCCTCGACTTCCACCTGTCGAAGCGCACGGGCGAGGTG
CTGTCGGCGCTCAACAAGGGCTCCGCCATCAACCAGTTTCTCGAGCAGGTGACGTTCCAGGTCGTGCCCATGCTC
TTCGACCTGTTTCTCTCCATCTCCGTCTTTTACTTCCAGTACGGCCCCCTCTATGCCGAGATCAATCTCGTCGAC
ACGTGCTGGTACCTTTACATGACGATCAAGATGGCCTCGACGCGGGCCGACCAGCGTCGCGAGATGACGAACGCC
GACCGCGAGGAGGAGGCGGTCAAGAATGACTCCATCTCGAGCTACGAGACGGTCAAGTACTTCAACGCCGAGGAG
TACGAGGCCAACCGATACCGCGACAAGGTGGCCGTCTTCCAGGCCGCCGAGGCCAAGGTGCAGATGGGCATGGTG
ATGATGAACATCTGCCAGACGCTCGTCTTCAACCTCGGCCGCATCGTGGCCGCCGTCGTGTGCGGCTGGCAGGTG
GCCGTCGGCATGAGGAGCACGGGCGACTGGTTCATGGTGGTTTCGTACCTGACGCAGTTACAGGGTCCTCTCAAC
TTCTTCGGTACCTTTTACCGTACCGTCCAACAGGCCATGATATCGGGCGAGCGCCTGCTGGAGCTCTTCAAGATC
GATCCGGGCGTCGTCGACGCGCCTCACGCGGTCCCTCTCCAAGACTTTCGCGGTCACATACGGTGGAAGAACGTC
AGCTTCGCCTACGATAGGCGGCGGCCGGCCCTGCGCAACGTCAGCTTCGAGTGCTTGCCGGGCACGACGACGGCC
TTTATCGGCGAGTCGGGCGGTGGCAAGTCGACGCTGTTCCGCCACATGTTCCGCTACTACGACTGTCACGAGGGC
AGCATCGAGCTGGACGGCAAGAACGTCAGGGATCTCACCATCAGCTCCGTCCGGAGTCACATTGGCGTCGTCCCG
CAGGACACGAGCCTCTTCAACGAGTCGCTCATGTACAACCTCAAATATGCCAACCCGGAGGCGACGACGGCGCAG
GTACACGCCGCCTGCGCAGCCGCCAGCATCCACGACCGCATCATGTCCTTCCCGGACCAGTACGAGACGCAGGTG
GGAGAGCGGGGGCTGCGTCTGAGCGGCGGCGAGAAGCAGCGCGTCGCCATTGCGCGCACCATTCTCAAGAACCCG
CGCATCATCATGCTGGACGAGGCCACTTCGGCTCTGGACACGCACACGGAACAGGAGATTCAGAACAACGTGTGG
GAGGTGGGCCAGGGACGCACCCTGCTCGTCATCGCCCACCGATTGTCGACGATTACGCACGCTGACCAGATCATC
GTCCTGCACGCCGGAGAGATTGTCGAGCGAGGGACGCATAAGGAGCTCCTCGCCGCTCGCGGACGCTACGCCTCG
ATGTGGGAGAAGCAGATTCGGGCTGAGAGGGCCCTGGATAAAGCGAGAGAGGCAACCATGAAGGCGAACAAGGCA
CTCAAGAGAGCCAACATGAATGCCAACGCTGAAGTGGCGGAAGACCAAGCAGAGGACTATCATGCCCTCGGATCC
TCGGGCATCTTGACGGATAACGACACGTCCAAGAGCAAGGCCGACGACGGAGAATGCTCGAGCTCCTCTTCGTCT
TCGAGCTCGCCCTCGTCGTCATCGTCGGATGCCGGTTCGTCGCACGATGCCGACGGTCCTGCCAGGCGACAGTCG
AACGCCAAGGCGCGGCGGTGA
Gene >Ophcf2|01956
ATGGAGGCCGAGGACGAGAGCCCGCCCTCAAGACGAGGTCCTGACCATGGCCACCCCGAAACATTGGTAGACCTG
ATCCTTCGCGAGATGCAGTACATCTACGCCCTTGTGCTCCTCGTCACCTTCCTCACCGGTGCCGCCTGGTATAGC
GTCTACAACGCCAAGCGGCAAGAGGTTCTTGCTCAACCCAAGGCCAAAGGCCCCGGCGGAAAACCGCTGCCGGTG
ACCAAGTCTAAGAAGCGCGACAGCGGACAGCGCAAACTCGGCCCCAGTTTCGGACCGGCTGCAAAAATCGTCTTT
CGCTACCTGGCCTTCGTCGTCTTCTCGACCTACGTCGCCAGCGGCGTCGCCCTGTTCGACCATGCCTTTTGGCAC
GAGAATCCCTACAAATGGTCCAAAGAAGGGCTTCCCTGGGCTGGAGAATGGACTGTGGTATGTGCCGGCTGCCCT
CCGAGAACCCTGCTCAACCGAGGTCTCTCTCGGGCCTTGCTCCCGGAGCCTCGTCCGCGAGGCTCCCCTTGTCGA
ATCGAACCCCCCTACTGACATGTGTGTGCGATGCAGGTTCACGTCATGGGTTCCACTTTCTTCTATCTATACCTA
CTCTTCTCCCTCTTCGACTGGCGCAAAGGCCCCAATGTCGTTCACCTGTTCGTCTGGACCCTCGGCCTGGCCGGT
GAATCCGTCATGTTCGCCGCCACCTTCGTCGCCGCCGCGCAGTGCCACTTTATGCCCCGCCTCGCTTCCGGGTCA
GACACCTGCATCGACTACTGGGCCAAGGTCGACCTTGTGCTCTATTTCCTTCGCTTCCTGCACCTGTTGGCCCTC
ATCAGCCTCTTTTGCTTGGCGTGGGTCTGCAAGGTCCGCCAACCCGGAGCCCGGATCGAGGAAGGTCGTGTGACC
GAGTCGACGCCACTGCTCAACGGCTCCTCCCGCGATGCCGGTACAGATGGCCTCTACGAGCGCAACCCGCGTCCC
CAATCGGAGCGTCGGCGCAGGCAGTCGACGTCGAGCCGGGACGACGCCGACGACACCGTCGACGGTGGGAACAAC
AATCCCAACAACGCCAGGCCGGCCGTCAAGGGCTCTTCCGGAAAGGACGAGACGGCGGCCTTTTACCGCCCGGAC
AAGCTCCCCCATCGTACTTGGTGGGAGTATCTGAGGGGATACTCCCTCTTCTTCCCTTACCTGTGGCCCAGGGAT
ACCCTCGTGCTGCAGTTGCACGTCCTCGTCTGCTTCGCCCTCGTCATTCTGCAGAGACTGGTCAACATGGCGGTC
CCCTATCAGATCGGTCGTGTCGTCAACAAGCTCGTTGCGGCCACCAAGGATGTGAGCAACGGACTGCCGCTCACC
AAGGAAAACTTTCCCCTGGCCGATTTCGCCATCCTCGGCGCGCTCTGGATCCTCCAGGGCCAGTCGGGTCTGCTG
GGCTCGCTGAGGTCGCTGCTGTGGATTCCCGTCTCGCAGTATTCGTACCGGGGCTTGACCACGGCCGCCTTCAAC
CACGTGCACTCGCTCAGCCTCGACTTCCACCTGTCGAAGCGCACGGGCGAGGTGCTGTCGGCGCTCAACAAGGGC
TCCGCCATCAACCAGTTTCTCGAGCAGGTGACGTTCCAGGTCGTGCCCATGCTCTTCGACCTGTTTCTCTCCATC
TCCGTCTTTTACTTCCAGTACGGCCCCCTCTATGCCGAGATCAATCTCGTCGACACGTGCTGGTACCTTTACATG
ACGATCAAGATGGCCTCGACGCGGGCCGACCAGCGTCGCGAGATGACGAACGCCGACCGCGAGGAGGAGGCGGTC
AAGAATGACTCCATCTCGAGCTACGAGACGGTCAAGTACTTCAACGCCGAGGAGTACGAGGCCAACCGATACCGC
GACAAGGTGGCCGTCTTCCAGGCCGCCGAGGCCAAGGTGCAGATGGGCATGGTGATGATGAACATCTGCCAGACG
CTCGTCTTCAACCTCGGCCGCATCGTGGCCGCCGTCGTGTGCGGCTGGCAGGTGGCCGTCGGCATGAGGAGCACG
GGCGACTGGTTCATGGTGGTTTCGTACCTGACGCAGTTACAGGGTCCTCTCAACTTCTTCGGTACCTTTTACCGT
ACCGTCCAACAGGCCATGATATCGGGCGAGCGCCTGCTGGAGCTCTTCAAGATCGATCCGGGCGTCGTCGACGCG
CCTCACGCGGTCCCTCTCCAAGACTTTCGCGGTCACATACGGTGGAAGAACGTCAGCTTCGCCTACGATAGGCGG
CGGCCGGCCCTGCGCAACGTCAGCTTCGAGTGCTTGCCGGGCACGACGACGGCCTTTATCGGCGAGTCGGGCGGT
GGCAAGTCGACGCTGTTCCGCCACATGTTCCGCTACTACGACTGTCACGAGGGCAGCATCGAGCTGGACGGCAAG
AACGTCAGGGATCTCACCATCAGCTCCGTCCGGAGTCACATTGGCGTCGTCCCGCAGGACACGAGCCTCTTCAAC
GAGTCGCTCATGTACAACCTCAAATATGCCAACCCGGAGGCGACGACGGCGCAGGTACACGCCGCCTGCGCAGCC
GCCAGCATCCACGACCGCATCATGTCCTTCCCGGACCAGTACGAGACGCAGGTGGGAGAGCGGGGGCTGCGTCTG
AGCGGCGGCGAGAAGCAGCGCGTCGCCATTGCGCGCACCATTCTCAAGAACCCGCGCATCATCATGCTGGACGAG
GCCACTTCGGCTCTGGACACGCACACGGAACAGGAGATTCAGAACAACGTGTGGGAGGTGGGCCAGGGACGCACC
CTGCTCGTCATCGCGTGAGTGTTCTGCAAATACTTGACAGGGCAAAGCTGACGCTGGTCGGGCAGCCACCGATTG
TCGACGATTACGCACGCTGACCAGATCATCGTCCTGCACGCCGGAGAGATTGTCGAGCGAGGGACGCATAAGGAG
CTCCTCGCCGCTCGCGGACGCTACGCCTCGATGTGGGAGAAGCAGATTCGGGCTGAGAGGGCCCTGGATAAAGCG
AGAGAGGCAACCATGAAGGCGAACAAGGCACTCAAGAGAGCCAACATGAATGCCAACGCTGAAGTGGCGGAAGAC
CAAGCAGAGGACTATCATGCCCTCGGATCCTCGGGCATCTTGACGGATAACGACACGTCCAAGAGCAAGGCCGAC
GACGGAGAATGCTCGAGCTCCTCTTCGTCTTCGAGCTCGCCCTCGTCGTCATCGTCGGATGCCGGTTCGTCGCAC
GATGCCGACGGTCCTGCCAGGCGACAGTCGAACGCCAAGGCGCGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail