Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01948
Gene name
Locationscaffold_02:2166018..2169471
Strand-
Gene length (bp)3453
Transcript length (bp)3396
Coding sequence length (bp)3396
Protein length (aa) 1132

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18136 DNApol_Exo DNA mitochondrial polymerase exonuclease domain 3.9E-102 102 381
PF00476 DNA_pol_A DNA polymerase family A 1.1E-35 605 956

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034061 DNA polymerase activity No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.154 0.1516 0.0584 0.053 0.928 0.0687 0.036 0.0352 0.06 0.0181

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2253
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3181
Ophiocordyceps australis map64 (Brazil) OphauB2|2626
Ophiocordyceps camponoti-floridani Ophcf2|01948 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3717
Ophiocordyceps kimflemingae Ophio5|5911
Ophiocordyceps subramaniannii Hirsu2|2922

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01948
MFRSSSRLRHLANNGFTHVSRQQTSRRLVLRRWLATSKGRSTLAVASQPRFNEIGVQHLSDHVFNQIFPNGCKPP
PKELVKLSKEHLRRHDLLGKTTDNSDPIAFDLPALQGRTLDEHFFRLGNDCAEPYLTLAKDFVQVELPKKPSSWV
RRSGWTKYYPDGRTEAVEAPDDVMLCFDTETLYKESPFSVMACAASPSAWFVWLSPWLLGESKCDRHLIPLGDPA
KARIIVGHNIGYDRARVLEEYNLEQSRNAFLDTMSFHVAVNGMCSRQRPTWMKHKKERELREKVAAETPDHDLAE
LLSRHGPNEEEEELWVERSSINSLRDVAKFHLDVSLDKTVRDDFGTLDRDGVLAKLDELLDYCATDVSITHRIYQ
IVFPNFLTVCPHPVSFAALRHLSSVILPVNRSWDEYIAGAEAKYRELSDAVHERLVGLTEKALALKDDAAQWEED
PWLKQLDWSGQEIRMVKGKRKGDPERPAARQKKPGMPRWYKDLFAKNDSPMNITVRTRIAPLLLKMSWDGHPLFW
SDKYGWTFRVPKDQAATYTAKQMIECEFEEGDPVLRDDHDHAYIKLPHKDGPTARCANVLAKGYLAFFENGILSS
AYSYAKEALEMNASCSYWISARDRITSQLVVYENDLSQSQTKGKGKKGRKKLKGNENGFILPQIIPMGTITRRAV
ENTWLTASNAKKNRVGSELKAMIKAPDGYCFVGADVDSQELWIASLVGDATFKLHGGNAVGFMTLEGTKAAGTDL
HSRTAAILGISRNDAKVFNYGRIYGAGLKFAATLLRQFNPSLTEKETTDTATKLYANTKGTKTNRKALYQRPFWR
GGTESLVFNKLEEFAEQERPRTPVLGAGITEALMARYISKGGYLTSRINWAIQSSGVDYLHLLIVSMNYLISRYG
IDARLAITVHDEIRYLVKAKDRYRAALALQVANVWTRAMFAQQVGIDDLPQSCAYFSAVDIDHVLRKEVDMECVT
PSHPTPIPPGESLDIKGILDKGNEAKLTRIAAAEAEDALNLRRVEYVPRKAVMESMRETSGDSLAFIKAQVANEF
ELRDLIKSAKPAAIKDKNYTKYKKSSQQPLMRQPYPHLVPKETLSVTEVMESTFRRGSNELNRWPWSNNNAAKGP
RPASRI*
Coding >Ophcf2|01948
ATGTTCAGGTCTTCAAGCCGTCTTCGCCACCTGGCCAACAACGGCTTCACTCATGTCAGCCGCCAACAGACCTCC
CGTCGTCTCGTGCTGAGGCGTTGGCTGGCGACTTCTAAAGGACGCAGCACTCTTGCAGTTGCCTCGCAGCCGCGC
TTCAACGAGATTGGCGTTCAGCATTTGAGCGACCATGTGTTCAACCAAATCTTTCCCAATGGCTGCAAGCCGCCG
CCAAAGGAGCTGGTCAAGCTCTCGAAAGAGCATCTGCGCCGCCATGACCTCCTGGGCAAGACCACTGACAATTCA
GACCCAATTGCCTTTGATCTGCCGGCTTTACAAGGCCGGACTCTGGACGAGCATTTCTTCAGGCTGGGAAACGAC
TGCGCTGAGCCGTACCTGACGCTGGCAAAGGATTTTGTCCAGGTTGAACTTCCGAAAAAACCCAGCAGTTGGGTG
CGACGAAGTGGCTGGACCAAGTATTACCCGGACGGGCGAACTGAAGCCGTCGAGGCGCCAGACGACGTCATGCTC
TGCTTCGACACTGAGACACTATACAAAGAGAGTCCCTTCTCGGTCATGGCTTGCGCGGCGAGCCCTAGCGCCTGG
TTCGTCTGGCTATCGCCTTGGCTGCTGGGCGAGTCGAAATGCGATAGGCATCTGATCCCGCTCGGCGACCCTGCC
AAAGCTCGAATCATTGTGGGCCACAACATCGGCTACGACCGAGCCAGAGTGTTGGAAGAGTACAACCTAGAACAG
TCGCGAAACGCCTTCCTCGACACAATGTCTTTCCACGTGGCTGTCAATGGCATGTGTTCGCGACAACGACCGACT
TGGATGAAGCACAAGAAGGAGCGCGAGCTGAGAGAAAAGGTAGCCGCTGAAACGCCGGATCACGACCTTGCCGAG
CTTCTTAGCCGCCACGGCCCGAATGAGGAGGAGGAGGAACTGTGGGTGGAGAGAAGCTCAATCAACTCGTTGCGT
GATGTCGCCAAGTTTCATCTCGACGTGTCGCTTGACAAGACGGTCCGAGATGACTTTGGGACTCTCGATCGGGAT
GGCGTCTTAGCCAAGCTCGACGAATTGTTGGACTATTGTGCTACGGATGTGTCCATCACTCACAGGATCTACCAG
ATTGTCTTCCCCAACTTCCTGACCGTCTGTCCGCATCCAGTCAGCTTTGCTGCGCTGCGCCACCTCAGTTCCGTC
ATTCTTCCAGTCAACAGATCATGGGATGAATACATTGCCGGGGCAGAGGCCAAATATCGCGAGCTCTCAGACGCC
GTCCATGAGCGGCTCGTTGGCCTCACCGAGAAGGCGCTCGCGCTCAAGGACGACGCGGCTCAGTGGGAGGAGGAT
CCGTGGCTGAAGCAGCTTGACTGGTCCGGCCAAGAAATCCGCATGGTCAAGGGCAAGCGCAAAGGCGACCCCGAA
AGGCCAGCCGCGAGGCAAAAGAAGCCAGGCATGCCCCGGTGGTACAAAGATCTCTTTGCTAAAAACGACTCTCCC
ATGAACATTACTGTCAGAACCCGCATAGCACCATTGCTCCTGAAGATGTCGTGGGACGGCCATCCCCTCTTCTGG
TCGGACAAATACGGCTGGACTTTCAGAGTGCCCAAGGATCAGGCGGCCACTTATACGGCCAAGCAGATGATTGAA
TGCGAGTTCGAAGAGGGCGACCCTGTCCTACGGGACGATCACGATCACGCTTACATCAAGCTACCGCACAAGGAC
GGTCCGACTGCCCGCTGTGCCAACGTGCTCGCCAAGGGTTATCTGGCCTTCTTCGAGAACGGCATCCTATCCTCG
GCGTATTCCTACGCCAAAGAAGCGCTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGTGCGCGCGACCGCATC
ACCAGTCAACTGGTCGTCTACGAAAACGACCTTTCACAATCGCAAACCAAGGGTAAAGGAAAGAAGGGCCGGAAG
AAGCTCAAGGGCAACGAAAATGGCTTCATCCTGCCACAGATCATTCCCATGGGGACCATCACCAGAAGAGCTGTG
GAGAACACGTGGCTCACGGCGAGCAATGCCAAAAAGAATCGCGTGGGCTCCGAGCTCAAGGCCATGATCAAGGCA
CCAGACGGCTACTGCTTCGTCGGCGCCGACGTCGACTCCCAGGAGCTGTGGATCGCCAGTCTCGTAGGGGACGCC
ACTTTCAAGCTCCACGGCGGAAACGCCGTAGGATTCATGACGCTCGAAGGCACCAAAGCTGCCGGAACGGACCTT
CACTCGCGGACGGCGGCCATCCTGGGCATCTCGAGGAACGACGCCAAGGTCTTCAACTACGGGCGCATCTACGGC
GCAGGGCTCAAGTTTGCGGCGACGCTGCTGCGGCAGTTCAACCCGTCGCTCACAGAGAAGGAGACGACGGACACG
GCGACGAAATTATACGCAAACACAAAGGGCACCAAGACAAACAGGAAAGCACTTTACCAGCGGCCCTTTTGGCGA
GGCGGCACCGAGTCTCTGGTCTTTAACAAACTCGAGGAATTTGCTGAGCAGGAGAGGCCGCGGACGCCGGTTCTG
GGAGCTGGCATCACCGAGGCGCTCATGGCCCGGTACATCAGCAAAGGCGGATATCTGACGTCACGCATCAACTGG
GCCATCCAGTCGTCGGGTGTCGATTATCTTCATCTGTTAATTGTGTCGATGAACTATCTCATCTCGCGGTACGGC
ATCGACGCTCGGCTGGCAATCACGGTACACGACGAAATTCGTTATCTGGTCAAGGCGAAAGACAGATACAGAGCC
GCGCTGGCCCTTCAGGTGGCCAACGTCTGGACACGGGCCATGTTCGCGCAGCAGGTAGGCATAGACGACCTGCCC
CAGTCGTGCGCCTACTTTTCCGCCGTCGATATCGACCACGTACTCCGCAAAGAGGTGGACATGGAGTGCGTGACG
CCCAGCCATCCGACGCCGATCCCTCCGGGCGAGAGTCTGGATATCAAGGGGATACTGGACAAGGGAAATGAGGCG
AAGCTAACCCGGATCGCCGCAGCCGAGGCGGAGGATGCGCTCAATCTGCGACGCGTGGAGTACGTGCCCCGCAAG
GCGGTGATGGAGTCGATGCGAGAGACGTCTGGGGATAGTCTGGCCTTTATCAAGGCTCAGGTCGCCAACGAATTC
GAGCTACGGGACCTCATCAAGAGCGCCAAGCCGGCGGCGATCAAGGACAAGAACTACACCAAGTACAAGAAGTCG
TCGCAGCAGCCCTTGATGCGCCAGCCCTACCCGCACCTGGTCCCAAAGGAGACGCTGTCGGTGACGGAGGTGATG
GAGTCGACGTTTCGCCGCGGCAGCAACGAGCTAAACCGGTGGCCGTGGTCCAACAACAATGCCGCCAAGGGGCCG
CGGCCTGCGTCGAGAATTTGA
Transcript >Ophcf2|01948
ATGTTCAGGTCTTCAAGCCGTCTTCGCCACCTGGCCAACAACGGCTTCACTCATGTCAGCCGCCAACAGACCTCC
CGTCGTCTCGTGCTGAGGCGTTGGCTGGCGACTTCTAAAGGACGCAGCACTCTTGCAGTTGCCTCGCAGCCGCGC
TTCAACGAGATTGGCGTTCAGCATTTGAGCGACCATGTGTTCAACCAAATCTTTCCCAATGGCTGCAAGCCGCCG
CCAAAGGAGCTGGTCAAGCTCTCGAAAGAGCATCTGCGCCGCCATGACCTCCTGGGCAAGACCACTGACAATTCA
GACCCAATTGCCTTTGATCTGCCGGCTTTACAAGGCCGGACTCTGGACGAGCATTTCTTCAGGCTGGGAAACGAC
TGCGCTGAGCCGTACCTGACGCTGGCAAAGGATTTTGTCCAGGTTGAACTTCCGAAAAAACCCAGCAGTTGGGTG
CGACGAAGTGGCTGGACCAAGTATTACCCGGACGGGCGAACTGAAGCCGTCGAGGCGCCAGACGACGTCATGCTC
TGCTTCGACACTGAGACACTATACAAAGAGAGTCCCTTCTCGGTCATGGCTTGCGCGGCGAGCCCTAGCGCCTGG
TTCGTCTGGCTATCGCCTTGGCTGCTGGGCGAGTCGAAATGCGATAGGCATCTGATCCCGCTCGGCGACCCTGCC
AAAGCTCGAATCATTGTGGGCCACAACATCGGCTACGACCGAGCCAGAGTGTTGGAAGAGTACAACCTAGAACAG
TCGCGAAACGCCTTCCTCGACACAATGTCTTTCCACGTGGCTGTCAATGGCATGTGTTCGCGACAACGACCGACT
TGGATGAAGCACAAGAAGGAGCGCGAGCTGAGAGAAAAGGTAGCCGCTGAAACGCCGGATCACGACCTTGCCGAG
CTTCTTAGCCGCCACGGCCCGAATGAGGAGGAGGAGGAACTGTGGGTGGAGAGAAGCTCAATCAACTCGTTGCGT
GATGTCGCCAAGTTTCATCTCGACGTGTCGCTTGACAAGACGGTCCGAGATGACTTTGGGACTCTCGATCGGGAT
GGCGTCTTAGCCAAGCTCGACGAATTGTTGGACTATTGTGCTACGGATGTGTCCATCACTCACAGGATCTACCAG
ATTGTCTTCCCCAACTTCCTGACCGTCTGTCCGCATCCAGTCAGCTTTGCTGCGCTGCGCCACCTCAGTTCCGTC
ATTCTTCCAGTCAACAGATCATGGGATGAATACATTGCCGGGGCAGAGGCCAAATATCGCGAGCTCTCAGACGCC
GTCCATGAGCGGCTCGTTGGCCTCACCGAGAAGGCGCTCGCGCTCAAGGACGACGCGGCTCAGTGGGAGGAGGAT
CCGTGGCTGAAGCAGCTTGACTGGTCCGGCCAAGAAATCCGCATGGTCAAGGGCAAGCGCAAAGGCGACCCCGAA
AGGCCAGCCGCGAGGCAAAAGAAGCCAGGCATGCCCCGGTGGTACAAAGATCTCTTTGCTAAAAACGACTCTCCC
ATGAACATTACTGTCAGAACCCGCATAGCACCATTGCTCCTGAAGATGTCGTGGGACGGCCATCCCCTCTTCTGG
TCGGACAAATACGGCTGGACTTTCAGAGTGCCCAAGGATCAGGCGGCCACTTATACGGCCAAGCAGATGATTGAA
TGCGAGTTCGAAGAGGGCGACCCTGTCCTACGGGACGATCACGATCACGCTTACATCAAGCTACCGCACAAGGAC
GGTCCGACTGCCCGCTGTGCCAACGTGCTCGCCAAGGGTTATCTGGCCTTCTTCGAGAACGGCATCCTATCCTCG
GCGTATTCCTACGCCAAAGAAGCGCTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGTGCGCGCGACCGCATC
ACCAGTCAACTGGTCGTCTACGAAAACGACCTTTCACAATCGCAAACCAAGGGTAAAGGAAAGAAGGGCCGGAAG
AAGCTCAAGGGCAACGAAAATGGCTTCATCCTGCCACAGATCATTCCCATGGGGACCATCACCAGAAGAGCTGTG
GAGAACACGTGGCTCACGGCGAGCAATGCCAAAAAGAATCGCGTGGGCTCCGAGCTCAAGGCCATGATCAAGGCA
CCAGACGGCTACTGCTTCGTCGGCGCCGACGTCGACTCCCAGGAGCTGTGGATCGCCAGTCTCGTAGGGGACGCC
ACTTTCAAGCTCCACGGCGGAAACGCCGTAGGATTCATGACGCTCGAAGGCACCAAAGCTGCCGGAACGGACCTT
CACTCGCGGACGGCGGCCATCCTGGGCATCTCGAGGAACGACGCCAAGGTCTTCAACTACGGGCGCATCTACGGC
GCAGGGCTCAAGTTTGCGGCGACGCTGCTGCGGCAGTTCAACCCGTCGCTCACAGAGAAGGAGACGACGGACACG
GCGACGAAATTATACGCAAACACAAAGGGCACCAAGACAAACAGGAAAGCACTTTACCAGCGGCCCTTTTGGCGA
GGCGGCACCGAGTCTCTGGTCTTTAACAAACTCGAGGAATTTGCTGAGCAGGAGAGGCCGCGGACGCCGGTTCTG
GGAGCTGGCATCACCGAGGCGCTCATGGCCCGGTACATCAGCAAAGGCGGATATCTGACGTCACGCATCAACTGG
GCCATCCAGTCGTCGGGTGTCGATTATCTTCATCTGTTAATTGTGTCGATGAACTATCTCATCTCGCGGTACGGC
ATCGACGCTCGGCTGGCAATCACGGTACACGACGAAATTCGTTATCTGGTCAAGGCGAAAGACAGATACAGAGCC
GCGCTGGCCCTTCAGGTGGCCAACGTCTGGACACGGGCCATGTTCGCGCAGCAGGTAGGCATAGACGACCTGCCC
CAGTCGTGCGCCTACTTTTCCGCCGTCGATATCGACCACGTACTCCGCAAAGAGGTGGACATGGAGTGCGTGACG
CCCAGCCATCCGACGCCGATCCCTCCGGGCGAGAGTCTGGATATCAAGGGGATACTGGACAAGGGAAATGAGGCG
AAGCTAACCCGGATCGCCGCAGCCGAGGCGGAGGATGCGCTCAATCTGCGACGCGTGGAGTACGTGCCCCGCAAG
GCGGTGATGGAGTCGATGCGAGAGACGTCTGGGGATAGTCTGGCCTTTATCAAGGCTCAGGTCGCCAACGAATTC
GAGCTACGGGACCTCATCAAGAGCGCCAAGCCGGCGGCGATCAAGGACAAGAACTACACCAAGTACAAGAAGTCG
TCGCAGCAGCCCTTGATGCGCCAGCCCTACCCGCACCTGGTCCCAAAGGAGACGCTGTCGGTGACGGAGGTGATG
GAGTCGACGTTTCGCCGCGGCAGCAACGAGCTAAACCGGTGGCCGTGGTCCAACAACAATGCCGCCAAGGGGCCG
CGGCCTGCGTCGAGAATTTGA
Gene >Ophcf2|01948
ATGTTCAGGTCTTCAAGCCGTCTTCGCCACCTGGCCAACAACGGCTTCACTCATGTCAGCCGCCAACAGACCTCC
CGTCGTCTCGTGCTGAGGCGTTGGCTGGCGACTTCTAAAGGACGCAGCACTCTTGCAGGTGGGATTTTCCTCTGG
AATTGAGTCGGTGCAAAGGCATTGACAGTCCGGGAACCAGTTGCCTCGCAGCCGCGCTTCAACGAGATTGGCGTT
CAGCATTTGAGCGACCATGTGTTCAACCAAATCTTTCCCAATGGCTGCAAGCCGCCGCCAAAGGAGCTGGTCAAG
CTCTCGAAAGAGCATCTGCGCCGCCATGACCTCCTGGGCAAGACCACTGACAATTCAGACCCAATTGCCTTTGAT
CTGCCGGCTTTACAAGGCCGGACTCTGGACGAGCATTTCTTCAGGCTGGGAAACGACTGCGCTGAGCCGTACCTG
ACGCTGGCAAAGGATTTTGTCCAGGTTGAACTTCCGAAAAAACCCAGCAGTTGGGTGCGACGAAGTGGCTGGACC
AAGTATTACCCGGACGGGCGAACTGAAGCCGTCGAGGCGCCAGACGACGTCATGCTCTGCTTCGACACTGAGACA
CTATACAAAGAGAGTCCCTTCTCGGTCATGGCTTGCGCGGCGAGCCCTAGCGCCTGGTTCGTCTGGCTATCGCCT
TGGCTGCTGGGCGAGTCGAAATGCGATAGGCATCTGATCCCGCTCGGCGACCCTGCCAAAGCTCGAATCATTGTG
GGCCACAACATCGGCTACGACCGAGCCAGAGTGTTGGAAGAGTACAACCTAGAACAGTCGCGAAACGCCTTCCTC
GACACAATGTCTTTCCACGTGGCTGTCAATGGCATGTGTTCGCGACAACGACCGACTTGGATGAAGCACAAGAAG
GAGCGCGAGCTGAGAGAAAAGGTAGCCGCTGAAACGCCGGATCACGACCTTGCCGAGCTTCTTAGCCGCCACGGC
CCGAATGAGGAGGAGGAGGAACTGTGGGTGGAGAGAAGCTCAATCAACTCGTTGCGTGATGTCGCCAAGTTTCAT
CTCGACGTGTCGCTTGACAAGACGGTCCGAGATGACTTTGGGACTCTCGATCGGGATGGCGTCTTAGCCAAGCTC
GACGAATTGTTGGACTATTGTGCTACGGATGTGTCCATCACTCACAGGATCTACCAGATTGTCTTCCCCAACTTC
CTGACCGTCTGTCCGCATCCAGTCAGCTTTGCTGCGCTGCGCCACCTCAGTTCCGTCATTCTTCCAGTCAACAGA
TCATGGGATGAATACATTGCCGGGGCAGAGGCCAAATATCGCGAGCTCTCAGACGCCGTCCATGAGCGGCTCGTT
GGCCTCACCGAGAAGGCGCTCGCGCTCAAGGACGACGCGGCTCAGTGGGAGGAGGATCCGTGGCTGAAGCAGCTT
GACTGGTCCGGCCAAGAAATCCGCATGGTCAAGGGCAAGCGCAAAGGCGACCCCGAAAGGCCAGCCGCGAGGCAA
AAGAAGCCAGGCATGCCCCGGTGGTACAAAGATCTCTTTGCTAAAAACGACTCTCCCATGAACATTACTGTCAGA
ACCCGCATAGCACCATTGCTCCTGAAGATGTCGTGGGACGGCCATCCCCTCTTCTGGTCGGACAAATACGGCTGG
ACTTTCAGAGTGCCCAAGGATCAGGCGGCCACTTATACGGCCAAGCAGATGATTGAATGCGAGTTCGAAGAGGGC
GACCCTGTCCTACGGGACGATCACGATCACGCTTACATCAAGCTACCGCACAAGGACGGTCCGACTGCCCGCTGT
GCCAACGTGCTCGCCAAGGGTTATCTGGCCTTCTTCGAGAACGGCATCCTATCCTCGGCGTATTCCTACGCCAAA
GAAGCGCTGGAGATGAACGCGTCTTGCTCTTACTGGATCAGTGCGCGCGACCGCATCACCAGTCAACTGGTCGTC
TACGAAAACGACCTTTCACAATCGCAAACCAAGGGTAAAGGAAAGAAGGGCCGGAAGAAGCTCAAGGGCAACGAA
AATGGCTTCATCCTGCCACAGATCATTCCCATGGGGACCATCACCAGAAGAGCTGTGGAGAACACGTGGCTCACG
GCGAGCAATGCCAAAAAGAATCGCGTGGGCTCCGAGCTCAAGGCCATGATCAAGGCACCAGACGGCTACTGCTTC
GTCGGCGCCGACGTCGACTCCCAGGAGCTGTGGATCGCCAGTCTCGTAGGGGACGCCACTTTCAAGCTCCACGGC
GGAAACGCCGTAGGATTCATGACGCTCGAAGGCACCAAAGCTGCCGGAACGGACCTTCACTCGCGGACGGCGGCC
ATCCTGGGCATCTCGAGGAACGACGCCAAGGTCTTCAACTACGGGCGCATCTACGGCGCAGGGCTCAAGTTTGCG
GCGACGCTGCTGCGGCAGTTCAACCCGTCGCTCACAGAGAAGGAGACGACGGACACGGCGACGAAATTATACGCA
AACACAAAGGGCACCAAGACAAACAGGAAAGCACTTTACCAGCGGCCCTTTTGGCGAGGCGGCACCGAGTCTCTG
GTCTTTAACAAACTCGAGGAATTTGCTGAGCAGGAGAGGCCGCGGACGCCGGTTCTGGGAGCTGGCATCACCGAG
GCGCTCATGGCCCGGTACATCAGCAAAGGCGGATATCTGACGTCACGCATCAACTGGGCCATCCAGTCGTCGGGT
GTCGATTATCTTCATCTGTTAATTGTGTCGATGAACTATCTCATCTCGCGGTACGGCATCGACGCTCGGCTGGCA
ATCACGGTACACGACGAAATTCGTTATCTGGTCAAGGCGAAAGACAGATACAGAGCCGCGCTGGCCCTTCAGGTG
GCCAACGTCTGGACACGGGCCATGTTCGCGCAGCAGGTAGGCATAGACGACCTGCCCCAGTCGTGCGCCTACTTT
TCCGCCGTCGATATCGACCACGTACTCCGCAAAGAGGTGGACATGGAGTGCGTGACGCCCAGCCATCCGACGCCG
ATCCCTCCGGGCGAGAGTCTGGATATCAAGGGGATACTGGACAAGGGAAATGAGGCGAAGCTAACCCGGATCGCC
GCAGCCGAGGCGGAGGATGCGCTCAATCTGCGACGCGTGGAGTACGTGCCCCGCAAGGCGGTGATGGAGTCGATG
CGAGAGACGTCTGGGGATAGTCTGGCCTTTATCAAGGCTCAGGTCGCCAACGAATTCGAGCTACGGGACCTCATC
AAGAGCGCCAAGCCGGCGGCGATCAAGGACAAGAACTACACCAAGTACAAGAAGTCGTCGCAGCAGCCCTTGATG
CGCCAGCCCTACCCGCACCTGGTCCCAAAGGAGACGCTGTCGGTGACGGAGGTGATGGAGTCGACGTTTCGCCGC
GGCAGCAACGAGCTAAACCGGTGGCCGTGGTCCAACAACAATGCCGCCAAGGGGCCGCGGCCTGCGTCGAGAATT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail