Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01946
Gene name
Locationscaffold_02:2161811..2162816
Strand+
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12656 G-patch_2 G-patch domain 1.0E-18 202 252

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2475 0.8706 0.0719 0.0364 0.1331 0.001 0.0268 0.0093 0.0086 0.0034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3184
Ophiocordyceps australis map64 (Brazil) OphauB2|2623
Ophiocordyceps camponoti-floridani Ophcf2|01946 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3719
Ophiocordyceps kimflemingae Ophio5|5913
Ophiocordyceps subramaniannii Hirsu2|5377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01946
MTNQDKSRIALNFGAFKPSQTLPPPPAARPGGINLGKRPRADAFADSDSDDERPVQHEVITGFGIDGAETLRKPP
AKKRDLIIACPPNRDWRAELRAKRQRGPLPTSQRGVGTVEREPADDDKDVQWGLNVPSKREDADDSAEKPPTTTP
KINTTDNTSQPPPTADDEALDALLDRKPHRPKTIPLSEDAAYRRDVATAGAPSTLEDYEAMPVEDFGAALLRGMG
WDGNPRGPKVKEVRRRANRLGLGAKELNEAEDLGGWNQTKKRRPRLDEYRREESRRKDERRRHDDSYKRERERER
EQERDGYRGGRDGGSERERRRDDRYRDHERDRRR*
Coding >Ophcf2|01946
ATGACGAACCAAGACAAAAGCCGCATAGCCCTGAATTTTGGCGCATTCAAGCCATCACAAACACTACCACCACCA
CCAGCCGCCCGTCCCGGCGGAATCAACCTGGGCAAGAGACCACGCGCCGACGCCTTCGCCGACTCCGACTCCGAC
GATGAGCGTCCCGTCCAGCACGAGGTCATCACCGGCTTCGGCATCGATGGCGCAGAGACGCTGAGGAAACCGCCA
GCCAAGAAGAGGGATCTCATCATCGCCTGCCCGCCGAATCGCGACTGGCGTGCTGAGCTTAGGGCCAAGAGGCAG
CGTGGTCCTCTTCCTACATCGCAGCGTGGTGTAGGAACGGTCGAGAGGGAGCCTGCAGACGACGATAAGGATGTG
CAATGGGGCTTGAACGTGCCGTCCAAGAGGGAGGATGCGGATGATTCCGCCGAGAAACCGCCTACGACAACCCCA
AAGATCAACACCACCGACAACACATCGCAACCCCCCCCAACAGCCGACGACGAAGCCCTAGACGCCCTCCTCGAC
CGCAAACCCCACCGCCCGAAAACGATCCCCCTCTCCGAAGACGCCGCCTACCGCCGCGACGTCGCCACCGCCGGC
GCCCCCTCCACGCTGGAAGACTACGAAGCCATGCCGGTCGAAGACTTCGGCGCCGCCCTCCTCCGCGGCATGGGC
TGGGACGGCAACCCTCGCGGCCCCAAAGTCAAGGAGGTCCGCCGGCGAGCCAACCGCCTCGGCCTCGGCGCGAAG
GAGCTCAACGAGGCCGAGGACCTGGGCGGTTGGAACCAGACCAAGAAGAGGAGGCCTCGTCTGGATGAGTATCGG
AGGGAGGAGAGCAGGCGGAAGGACGAGCGCCGCCGGCATGACGATAGCTATAAGCGGGAACGGGAGCGGGAACGG
GAGCAGGAGCGTGATGGGTATAGAGGTGGGAGGGATGGGGGCTCCGAGCGGGAGAGGAGGCGTGATGATCGGTAT
CGCGATCATGAGAGGGATCGACGACGGTGA
Transcript >Ophcf2|01946
ATGACGAACCAAGACAAAAGCCGCATAGCCCTGAATTTTGGCGCATTCAAGCCATCACAAACACTACCACCACCA
CCAGCCGCCCGTCCCGGCGGAATCAACCTGGGCAAGAGACCACGCGCCGACGCCTTCGCCGACTCCGACTCCGAC
GATGAGCGTCCCGTCCAGCACGAGGTCATCACCGGCTTCGGCATCGATGGCGCAGAGACGCTGAGGAAACCGCCA
GCCAAGAAGAGGGATCTCATCATCGCCTGCCCGCCGAATCGCGACTGGCGTGCTGAGCTTAGGGCCAAGAGGCAG
CGTGGTCCTCTTCCTACATCGCAGCGTGGTGTAGGAACGGTCGAGAGGGAGCCTGCAGACGACGATAAGGATGTG
CAATGGGGCTTGAACGTGCCGTCCAAGAGGGAGGATGCGGATGATTCCGCCGAGAAACCGCCTACGACAACCCCA
AAGATCAACACCACCGACAACACATCGCAACCCCCCCCAACAGCCGACGACGAAGCCCTAGACGCCCTCCTCGAC
CGCAAACCCCACCGCCCGAAAACGATCCCCCTCTCCGAAGACGCCGCCTACCGCCGCGACGTCGCCACCGCCGGC
GCCCCCTCCACGCTGGAAGACTACGAAGCCATGCCGGTCGAAGACTTCGGCGCCGCCCTCCTCCGCGGCATGGGC
TGGGACGGCAACCCTCGCGGCCCCAAAGTCAAGGAGGTCCGCCGGCGAGCCAACCGCCTCGGCCTCGGCGCGAAG
GAGCTCAACGAGGCCGAGGACCTGGGCGGTTGGAACCAGACCAAGAAGAGGAGGCCTCGTCTGGATGAGTATCGG
AGGGAGGAGAGCAGGCGGAAGGACGAGCGCCGCCGGCATGACGATAGCTATAAGCGGGAACGGGAGCGGGAACGG
GAGCAGGAGCGTGATGGGTATAGAGGTGGGAGGGATGGGGGCTCCGAGCGGGAGAGGAGGCGTGATGATCGGTAT
CGCGATCATGAGAGGGATCGACGACGGTGA
Gene >Ophcf2|01946
ATGACGAACCAAGACAAAAGCCGCATAGCCCTGAATTTTGGCGCATTCAAGCCATCACAAACACTACCACCACCA
CCAGCCGCCCGTCCCGGCGGAATCAACCTGGGCAAGAGACCACGCGCCGACGCCTTCGCCGACTCCGACTCCGAC
GATGAGCGTCCCGTCCAGCACGAGGTCATCACCGGCTTCGGCATCGATGGCGCAGAGACGCTGAGGAAACCGCCA
GCCAAGAAGAGGGATCTCATCATCGCCTGCCCGCCGAATCGCGACTGGCGTGCTGAGCTTAGGGCCAAGAGGCAG
CGTGGTCCTCTTCCTACATCGCAGCGTGGTGTAGGAACGGTCGAGAGGGAGCCTGCAGACGACGATAAGGATGTG
CAATGGGGCTTGAACGTGCCGTCCAAGAGGGAGGATGCGGATGATTCCGCCGAGAAACCGCCTACGACAACCCCA
AAGATCAACACCACCGACAACACATCGCAACCCCCCCCAACAGCCGACGACGAAGCCCTAGACGCCCTCCTCGAC
CGCAAACCCCACCGCCCGAAAACGATCCCCCTCTCCGAAGACGCCGCCTACCGCCGCGACGTCGCCACCGCCGGC
GCCCCCTCCACGCTGGAAGACTACGAAGCCATGCCGGTCGAAGACTTCGGCGCCGCCCTCCTCCGCGGCATGGGC
TGGGACGGCAACCCTCGCGGCCCCAAAGTCAAGGAGGTCCGCCGGCGAGCCAACCGCCTCGGCCTCGGCGCGAAG
GAGCTCAACGAGGCCGAGGACCTGGGCGGTTGGAACCAGACCAAGAAGAGGAGGCCTCGTCTGGATGAGTATCGG
AGGGAGGAGAGCAGGCGGAAGGACGAGCGCCGCCGGCATGACGATAGCTATAAGCGGGAACGGGAGCGGGAACGG
GAGCAGGAGCGTGATGGGTATAGAGGTGGGAGGGATGGGGGCTCCGAGCGGGAGAGGAGGCGTGATGATCGGTAT
CGCGATCATGAGAGGGATCGACGACGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail