Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01944
Gene name
Locationscaffold_02:2155139..2160071
Strand-
Gene length (bp)4932
Transcript length (bp)4698
Coding sequence length (bp)4698
Protein length (aa) 1566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 3.5E-15 913 983
PF07529 HSA HSA domain 1.6E-11 637 688

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3176 0.8623 0.1487 0.0124 0.0999 0.0119 0.0275 0.0113 0.0348 0.0247

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|693
Ophiocordyceps australis map64 (Brazil) OphauB2|6545
Ophiocordyceps camponoti-floridani Ophcf2|01944 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7276
Ophiocordyceps kimflemingae Ophio5|5914
Ophiocordyceps subramaniannii Hirsu2|6802

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01944
MTEVGHVELSRILQSRRHECSSIVTARKRKLRELFAVATQVEPLPDEGFANLDAPAATQAEWQFLQASDMLQART
LTESNIPERPRVSLERLKRLVAESVNAAISCSSLDAPSSQNALSEARHGVNWNKSGGAIAKRSTTPIQPKMAAIA
QPQPPSIIIAPCTKQLLKASPHYVDTIESAVKDVGSGDPRKVNGDTSVHKKKEAVSRRTPQVTFPPGTKGSTTDP
ISDATPGPKSGSVQSKVNGHPGVDAADSHEEGDGLLSIKLPSDNSRVPDALSTPASSVPSATTPAVHDASTDTSP
DRDGPSYSDAARRKESDASSESSSQGSVTDVRARILSAGNRRPQAPAFPTAVQKESDVTAASRSQSGGEIGLAGD
MSANDGHGETNPGSHGLQPPVSASAHRPLPTEVPDSQDDSPEETGADALHQVKPEAEDSAVLPPPKSSSATADAA
SGLVIDTKSQPREEQDGPARAVTRVSTGAIRRKSVNEIVGGSSGVATRDAVGHGPHDQLTPVTSTPQSPSRMRST
GSTRKERSKSHASMVLFGKQPKRLEDKALAAGHKETIQISDDYYTPLFVQNFTGVAKWMQPLDRVLFQANKTVST
PDTQLVFQDHQACRILRKVYHLQQNDKWSLRQPKRCQEPTRPPCQWDVMLREMRWMRTDFREERKWKMVVARNLA
YACAEWHEAGPEERKEMQVLATIPPRAQPAELDVSMVDAGDDDDDLPRDHPTPDLVPSGEGNSPQDMDELAEAFD
ELAAPSAIFSLHDDDVVFGLRRTATADKLLGELPMYGLPLRVPKADMTSPEYDPDAHWRRPALPLSKYVEGHMKL
VTSCPPRKASRFSYDDEDEDADGDGLFIDNHHSDLGVKLPPMTDEVSLFHPDSKHIRDRLHAGHQFRPPSEHPMP
NQSFYESRSPSQWTLAEDDELRGLVREYSYNWSLISNMLSTRSSFVSGAERRTPWECFERWINLEGLPADMQKTQ
YFKAYNSRIEMAQRIIAQHNQLAAQQASASGGGVAPMRRRPSAPMRVEKRRNQKHLAMLDAMRKLAKKKETAAQK
QQHAAAQSAASKKACDAVPQRPIKTPRDYSLIRWERDQALAEKMAQFASRQEAQRRAAIQARAQQHAQAAHMAGA
QGSGMMGQNAGHQMGPNVGVNGARPMTAQNRPRMPMQAPVSNGVGPAPTQMNGSLSAPSQTSAAAAQPQAQHRMP
TMPPNTQQQGQQPDASLMMRAQRISEQQRAAVQIQQAQQQGHPQQQSLAQQQQQQQQQQQQQQQQPPVNSGTPNN
GTGQLNSPSMRNGVNQQSFMNNAQAMMASYAANGNGLGSPLPSGLHMPAAANVPSPGQRMHSQLPPNVAAQLSHL
EASFRAKKPNLTPEQARQLATEHLTRAMMTQRQNAMNAAAGASAQPGVANSVAATTTSPHQYAALLRQQQQAQQQ
VPQQAAHPLKAQQAQHLQHQQHQQHLLHLHQQQAQAQQQQQAQQQQQAQQQAQQQQAQQQQAQQQQQAQQQQQAQ
QQQAQQQRQQPQPKPQPQPYPQFAAANSAATPVPLATTPTQASASPVPSAQRPSSGSATPSAVGK*
Coding >Ophcf2|01944
ATGACTGAGGTCGGGCACGTCGAACTGTCGAGGATACTTCAGTCCAGGCGCCATGAGTGCAGTTCAATTGTGACG
GCGCGGAAGCGAAAGCTGCGTGAGCTCTTCGCGGTCGCGACACAGGTCGAGCCGCTACCGGACGAAGGCTTCGCC
AACCTCGACGCTCCGGCGGCCACACAGGCAGAATGGCAGTTTCTGCAAGCAAGCGACATGTTACAGGCCAGGACT
TTGACCGAGTCGAATATCCCCGAGCGGCCGCGCGTGTCACTGGAAAGATTGAAGCGGTTGGTCGCCGAGTCGGTC
AACGCCGCCATCAGCTGTTCGTCGTTGGACGCGCCGAGTTCACAGAACGCGCTATCCGAGGCCCGTCATGGCGTC
AACTGGAACAAGAGTGGAGGAGCTATCGCGAAGAGATCGACGACCCCGATTCAGCCAAAGATGGCAGCCATTGCG
CAACCGCAGCCGCCCTCGATCATCATCGCTCCGTGCACGAAGCAACTTCTCAAAGCGAGTCCACATTACGTCGAT
ACCATCGAGTCGGCTGTCAAAGATGTCGGCAGCGGCGATCCGCGCAAGGTCAACGGCGACACCAGTGTGCACAAG
AAGAAGGAAGCTGTTTCGAGACGGACGCCTCAAGTTACATTTCCTCCAGGCACCAAGGGCTCAACGACGGATCCC
ATCAGCGATGCGACTCCGGGTCCCAAATCCGGCAGCGTACAGAGCAAGGTCAACGGACACCCCGGCGTTGATGCT
GCCGATTCGCACGAAGAGGGCGACGGCTTGCTGTCGATTAAGCTCCCCTCGGATAATTCCAGGGTCCCCGATGCT
CTGTCGACGCCTGCATCCAGTGTGCCCAGCGCGACGACTCCTGCCGTTCATGATGCCTCGACGGATACCAGCCCC
GACCGTGATGGCCCGAGTTATTCGGATGCGGCCAGGAGAAAGGAGTCGGATGCGAGCAGCGAGTCGAGCAGCCAA
GGCAGCGTCACCGACGTCAGAGCCAGGATCTTGAGCGCAGGCAATCGCCGGCCGCAGGCGCCCGCCTTTCCCACG
GCAGTTCAGAAAGAAAGCGATGTGACGGCCGCGAGTCGAAGCCAGTCCGGCGGCGAGATCGGCCTTGCGGGCGAC
ATGTCGGCCAACGACGGCCACGGTGAGACGAATCCCGGCTCCCATGGGCTCCAGCCGCCCGTTTCTGCTTCGGCC
CATCGCCCGCTGCCGACTGAGGTGCCCGATAGTCAAGACGACTCTCCGGAAGAGACGGGGGCGGATGCTCTTCAC
CAAGTCAAGCCTGAGGCCGAGGACTCTGCTGTGCTGCCTCCACCAAAATCAAGCAGTGCCACTGCCGACGCTGCC
TCTGGCCTAGTCATCGACACCAAATCTCAGCCACGGGAGGAACAAGATGGGCCGGCGCGGGCAGTGACGAGAGTC
TCGACGGGCGCTATCCGGCGCAAGTCTGTCAACGAAATTGTCGGCGGCTCGTCAGGCGTCGCGACACGGGACGCC
GTCGGCCATGGGCCTCACGATCAGCTCACTCCCGTGACGTCAACGCCTCAGTCTCCCTCCCGGATGAGGAGTACT
GGCTCGACACGGAAAGAAAGGTCCAAGAGCCACGCGTCGATGGTTTTGTTCGGCAAGCAGCCTAAGCGGCTGGAG
GACAAAGCTCTCGCGGCCGGCCACAAGGAAACGATCCAGATCTCGGACGACTACTACACGCCTCTCTTCGTGCAA
AACTTCACTGGTGTCGCCAAGTGGATGCAGCCCCTGGACCGAGTCCTCTTCCAGGCCAACAAAACAGTGTCCACT
CCTGACACGCAGCTGGTTTTTCAGGACCACCAGGCCTGCAGGATCCTTCGCAAAGTCTACCACCTGCAGCAGAAC
GACAAGTGGTCCCTGCGTCAGCCCAAGCGGTGCCAGGAACCGACCAGGCCGCCCTGCCAGTGGGACGTGATGCTT
CGGGAGATGAGGTGGATGCGCACTGATTTCCGCGAGGAGCGCAAGTGGAAGATGGTCGTCGCGCGAAACTTGGCG
TATGCCTGTGCTGAGTGGCATGAAGCCGGGCCCGAAGAACGGAAGGAAATGCAGGTGTTGGCGACGATTCCTCCC
AGAGCGCAGCCCGCCGAGCTGGACGTTTCCATGGTCGATGCGGGCGATGACGATGACGATCTGCCGAGGGATCAT
CCTACGCCGGATCTCGTGCCATCTGGAGAGGGGAACTCGCCTCAAGATATGGATGAGCTCGCCGAGGCCTTTGAC
GAGCTGGCGGCGCCGTCTGCCATCTTTTCCCTGCACGATGATGACGTCGTCTTCGGCCTGCGGCGGACGGCGACT
GCGGATAAGTTGCTGGGGGAGCTTCCCATGTATGGGCTGCCGCTCAGAGTACCCAAGGCGGATATGACGAGTCCG
GAATACGACCCTGACGCACACTGGCGCCGCCCTGCCCTGCCGCTCAGCAAGTATGTCGAGGGGCATATGAAGCTG
GTGACCAGCTGCCCTCCCCGGAAGGCTAGCCGTTTCAGCTACGATGACGAGGACGAAGACGCTGACGGGGACGGC
CTTTTTATCGACAACCACCACTCCGATCTCGGCGTCAAGCTGCCGCCCATGACGGATGAGGTGTCTCTGTTCCAT
CCCGACTCGAAGCACATCCGGGATCGCCTGCACGCGGGTCACCAGTTCCGACCCCCGTCGGAGCATCCCATGCCG
AACCAGAGCTTCTATGAATCTCGCAGCCCCTCTCAGTGGACGCTGGCCGAGGACGATGAGCTCCGTGGACTCGTC
CGGGAGTACTCGTACAACTGGTCCCTCATTTCCAACATGCTGTCGACTCGCTCCAGCTTCGTGTCTGGTGCGGAG
CGACGAACGCCCTGGGAGTGCTTCGAACGGTGGATCAACCTCGAAGGCCTGCCGGCGGACATGCAGAAGACGCAG
TACTTCAAGGCCTACAACTCGAGGATCGAGATGGCGCAGAGAATCATCGCTCAGCACAACCAACTGGCTGCGCAA
CAGGCCAGCGCTTCAGGGGGGGGCGTGGCGCCGATGCGTAGGAGGCCATCGGCGCCGATGCGGGTGGAGAAGCGA
CGAAACCAGAAGCACCTGGCCATGCTGGACGCGATGCGGAAGCTGGCCAAGAAGAAGGAGACTGCGGCGCAGAAG
CAGCAGCACGCGGCGGCTCAGAGCGCTGCCAGCAAGAAGGCCTGCGACGCCGTCCCCCAGCGACCGATCAAGACT
CCGAGGGATTACAGTCTGATTCGATGGGAGAGGGACCAGGCTCTGGCTGAGAAGATGGCTCAGTTCGCGTCGCGT
CAAGAGGCTCAGCGACGAGCCGCTATACAAGCCAGAGCACAACAGCATGCGCAGGCTGCTCACATGGCCGGAGCG
CAGGGATCGGGCATGATGGGCCAGAACGCGGGTCATCAGATGGGACCCAACGTCGGCGTCAACGGGGCGCGTCCG
ATGACGGCACAGAACCGGCCCCGGATGCCGATGCAGGCGCCCGTCAGCAACGGAGTCGGTCCGGCTCCGACGCAG
ATGAACGGCAGCCTCTCGGCCCCGTCGCAGACGAGCGCCGCGGCGGCGCAACCGCAGGCACAGCACAGGATGCCG
ACGATGCCGCCCAACACGCAGCAGCAGGGTCAGCAGCCCGATGCCAGCCTGATGATGCGGGCCCAGCGCATCTCG
GAGCAGCAGCGTGCCGCCGTTCAGATTCAGCAGGCTCAGCAGCAGGGTCATCCGCAGCAGCAGTCGCTGGCTCAG
CAGCAACAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCCGCCTGTCAACTCGGGCACTCCCAACAAC
GGAACGGGCCAGCTCAACTCTCCGTCGATGCGCAACGGCGTCAACCAGCAGTCCTTTATGAACAACGCCCAGGCC
ATGATGGCCTCTTACGCTGCCAATGGCAACGGACTGGGCTCGCCGTTACCGAGCGGCCTGCACATGCCTGCCGCC
GCCAACGTCCCGTCTCCCGGACAGAGGATGCATTCGCAGTTACCGCCAAACGTCGCCGCTCAGCTCAGCCATCTG
GAGGCCTCGTTTCGAGCTAAGAAGCCGAACCTGACCCCGGAGCAGGCGCGGCAGCTGGCGACGGAACATCTGACG
CGAGCCATGATGACACAGCGGCAGAACGCCATGAACGCTGCTGCCGGAGCGTCTGCACAGCCGGGCGTCGCCAAC
AGCGTGGCGGCCACGACGACGAGCCCTCATCAGTACGCTGCCCTGCTCCGACAGCAGCAGCAGGCACAGCAGCAG
GTCCCTCAGCAGGCGGCACACCCTCTGAAGGCGCAGCAGGCGCAGCATCTGCAACACCAGCAGCATCAGCAGCAT
CTGCTTCACCTTCACCAGCAGCAGGCCCAGGCTCAGCAACAGCAGCAGGCTCAGCAACAGCAGCAGGCTCAGCAA
CAGGCTCAGCAACAACAGGCTCAGCAACAACAGGCTCAGCAACAGCAGCAAGCCCAGCAACAACAGCAAGCCCAG
CAACAACAAGCCCAGCAGCAGCGCCAGCAGCCACAGCCAAAGCCCCAGCCCCAGCCCTACCCGCAGTTCGCCGCC
GCAAACTCAGCAGCAACCCCCGTGCCCCTCGCCACAACTCCCACGCAGGCCTCCGCCAGTCCCGTCCCGTCCGCT
CAGCGCCCTTCAAGCGGTAGCGCCACGCCGTCAGCCGTCGGAAAGTGA
Transcript >Ophcf2|01944
ATGACTGAGGTCGGGCACGTCGAACTGTCGAGGATACTTCAGTCCAGGCGCCATGAGTGCAGTTCAATTGTGACG
GCGCGGAAGCGAAAGCTGCGTGAGCTCTTCGCGGTCGCGACACAGGTCGAGCCGCTACCGGACGAAGGCTTCGCC
AACCTCGACGCTCCGGCGGCCACACAGGCAGAATGGCAGTTTCTGCAAGCAAGCGACATGTTACAGGCCAGGACT
TTGACCGAGTCGAATATCCCCGAGCGGCCGCGCGTGTCACTGGAAAGATTGAAGCGGTTGGTCGCCGAGTCGGTC
AACGCCGCCATCAGCTGTTCGTCGTTGGACGCGCCGAGTTCACAGAACGCGCTATCCGAGGCCCGTCATGGCGTC
AACTGGAACAAGAGTGGAGGAGCTATCGCGAAGAGATCGACGACCCCGATTCAGCCAAAGATGGCAGCCATTGCG
CAACCGCAGCCGCCCTCGATCATCATCGCTCCGTGCACGAAGCAACTTCTCAAAGCGAGTCCACATTACGTCGAT
ACCATCGAGTCGGCTGTCAAAGATGTCGGCAGCGGCGATCCGCGCAAGGTCAACGGCGACACCAGTGTGCACAAG
AAGAAGGAAGCTGTTTCGAGACGGACGCCTCAAGTTACATTTCCTCCAGGCACCAAGGGCTCAACGACGGATCCC
ATCAGCGATGCGACTCCGGGTCCCAAATCCGGCAGCGTACAGAGCAAGGTCAACGGACACCCCGGCGTTGATGCT
GCCGATTCGCACGAAGAGGGCGACGGCTTGCTGTCGATTAAGCTCCCCTCGGATAATTCCAGGGTCCCCGATGCT
CTGTCGACGCCTGCATCCAGTGTGCCCAGCGCGACGACTCCTGCCGTTCATGATGCCTCGACGGATACCAGCCCC
GACCGTGATGGCCCGAGTTATTCGGATGCGGCCAGGAGAAAGGAGTCGGATGCGAGCAGCGAGTCGAGCAGCCAA
GGCAGCGTCACCGACGTCAGAGCCAGGATCTTGAGCGCAGGCAATCGCCGGCCGCAGGCGCCCGCCTTTCCCACG
GCAGTTCAGAAAGAAAGCGATGTGACGGCCGCGAGTCGAAGCCAGTCCGGCGGCGAGATCGGCCTTGCGGGCGAC
ATGTCGGCCAACGACGGCCACGGTGAGACGAATCCCGGCTCCCATGGGCTCCAGCCGCCCGTTTCTGCTTCGGCC
CATCGCCCGCTGCCGACTGAGGTGCCCGATAGTCAAGACGACTCTCCGGAAGAGACGGGGGCGGATGCTCTTCAC
CAAGTCAAGCCTGAGGCCGAGGACTCTGCTGTGCTGCCTCCACCAAAATCAAGCAGTGCCACTGCCGACGCTGCC
TCTGGCCTAGTCATCGACACCAAATCTCAGCCACGGGAGGAACAAGATGGGCCGGCGCGGGCAGTGACGAGAGTC
TCGACGGGCGCTATCCGGCGCAAGTCTGTCAACGAAATTGTCGGCGGCTCGTCAGGCGTCGCGACACGGGACGCC
GTCGGCCATGGGCCTCACGATCAGCTCACTCCCGTGACGTCAACGCCTCAGTCTCCCTCCCGGATGAGGAGTACT
GGCTCGACACGGAAAGAAAGGTCCAAGAGCCACGCGTCGATGGTTTTGTTCGGCAAGCAGCCTAAGCGGCTGGAG
GACAAAGCTCTCGCGGCCGGCCACAAGGAAACGATCCAGATCTCGGACGACTACTACACGCCTCTCTTCGTGCAA
AACTTCACTGGTGTCGCCAAGTGGATGCAGCCCCTGGACCGAGTCCTCTTCCAGGCCAACAAAACAGTGTCCACT
CCTGACACGCAGCTGGTTTTTCAGGACCACCAGGCCTGCAGGATCCTTCGCAAAGTCTACCACCTGCAGCAGAAC
GACAAGTGGTCCCTGCGTCAGCCCAAGCGGTGCCAGGAACCGACCAGGCCGCCCTGCCAGTGGGACGTGATGCTT
CGGGAGATGAGGTGGATGCGCACTGATTTCCGCGAGGAGCGCAAGTGGAAGATGGTCGTCGCGCGAAACTTGGCG
TATGCCTGTGCTGAGTGGCATGAAGCCGGGCCCGAAGAACGGAAGGAAATGCAGGTGTTGGCGACGATTCCTCCC
AGAGCGCAGCCCGCCGAGCTGGACGTTTCCATGGTCGATGCGGGCGATGACGATGACGATCTGCCGAGGGATCAT
CCTACGCCGGATCTCGTGCCATCTGGAGAGGGGAACTCGCCTCAAGATATGGATGAGCTCGCCGAGGCCTTTGAC
GAGCTGGCGGCGCCGTCTGCCATCTTTTCCCTGCACGATGATGACGTCGTCTTCGGCCTGCGGCGGACGGCGACT
GCGGATAAGTTGCTGGGGGAGCTTCCCATGTATGGGCTGCCGCTCAGAGTACCCAAGGCGGATATGACGAGTCCG
GAATACGACCCTGACGCACACTGGCGCCGCCCTGCCCTGCCGCTCAGCAAGTATGTCGAGGGGCATATGAAGCTG
GTGACCAGCTGCCCTCCCCGGAAGGCTAGCCGTTTCAGCTACGATGACGAGGACGAAGACGCTGACGGGGACGGC
CTTTTTATCGACAACCACCACTCCGATCTCGGCGTCAAGCTGCCGCCCATGACGGATGAGGTGTCTCTGTTCCAT
CCCGACTCGAAGCACATCCGGGATCGCCTGCACGCGGGTCACCAGTTCCGACCCCCGTCGGAGCATCCCATGCCG
AACCAGAGCTTCTATGAATCTCGCAGCCCCTCTCAGTGGACGCTGGCCGAGGACGATGAGCTCCGTGGACTCGTC
CGGGAGTACTCGTACAACTGGTCCCTCATTTCCAACATGCTGTCGACTCGCTCCAGCTTCGTGTCTGGTGCGGAG
CGACGAACGCCCTGGGAGTGCTTCGAACGGTGGATCAACCTCGAAGGCCTGCCGGCGGACATGCAGAAGACGCAG
TACTTCAAGGCCTACAACTCGAGGATCGAGATGGCGCAGAGAATCATCGCTCAGCACAACCAACTGGCTGCGCAA
CAGGCCAGCGCTTCAGGGGGGGGCGTGGCGCCGATGCGTAGGAGGCCATCGGCGCCGATGCGGGTGGAGAAGCGA
CGAAACCAGAAGCACCTGGCCATGCTGGACGCGATGCGGAAGCTGGCCAAGAAGAAGGAGACTGCGGCGCAGAAG
CAGCAGCACGCGGCGGCTCAGAGCGCTGCCAGCAAGAAGGCCTGCGACGCCGTCCCCCAGCGACCGATCAAGACT
CCGAGGGATTACAGTCTGATTCGATGGGAGAGGGACCAGGCTCTGGCTGAGAAGATGGCTCAGTTCGCGTCGCGT
CAAGAGGCTCAGCGACGAGCCGCTATACAAGCCAGAGCACAACAGCATGCGCAGGCTGCTCACATGGCCGGAGCG
CAGGGATCGGGCATGATGGGCCAGAACGCGGGTCATCAGATGGGACCCAACGTCGGCGTCAACGGGGCGCGTCCG
ATGACGGCACAGAACCGGCCCCGGATGCCGATGCAGGCGCCCGTCAGCAACGGAGTCGGTCCGGCTCCGACGCAG
ATGAACGGCAGCCTCTCGGCCCCGTCGCAGACGAGCGCCGCGGCGGCGCAACCGCAGGCACAGCACAGGATGCCG
ACGATGCCGCCCAACACGCAGCAGCAGGGTCAGCAGCCCGATGCCAGCCTGATGATGCGGGCCCAGCGCATCTCG
GAGCAGCAGCGTGCCGCCGTTCAGATTCAGCAGGCTCAGCAGCAGGGTCATCCGCAGCAGCAGTCGCTGGCTCAG
CAGCAACAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCCGCCTGTCAACTCGGGCACTCCCAACAAC
GGAACGGGCCAGCTCAACTCTCCGTCGATGCGCAACGGCGTCAACCAGCAGTCCTTTATGAACAACGCCCAGGCC
ATGATGGCCTCTTACGCTGCCAATGGCAACGGACTGGGCTCGCCGTTACCGAGCGGCCTGCACATGCCTGCCGCC
GCCAACGTCCCGTCTCCCGGACAGAGGATGCATTCGCAGTTACCGCCAAACGTCGCCGCTCAGCTCAGCCATCTG
GAGGCCTCGTTTCGAGCTAAGAAGCCGAACCTGACCCCGGAGCAGGCGCGGCAGCTGGCGACGGAACATCTGACG
CGAGCCATGATGACACAGCGGCAGAACGCCATGAACGCTGCTGCCGGAGCGTCTGCACAGCCGGGCGTCGCCAAC
AGCGTGGCGGCCACGACGACGAGCCCTCATCAGTACGCTGCCCTGCTCCGACAGCAGCAGCAGGCACAGCAGCAG
GTCCCTCAGCAGGCGGCACACCCTCTGAAGGCGCAGCAGGCGCAGCATCTGCAACACCAGCAGCATCAGCAGCAT
CTGCTTCACCTTCACCAGCAGCAGGCCCAGGCTCAGCAACAGCAGCAGGCTCAGCAACAGCAGCAGGCTCAGCAA
CAGGCTCAGCAACAACAGGCTCAGCAACAACAGGCTCAGCAACAGCAGCAAGCCCAGCAACAACAGCAAGCCCAG
CAACAACAAGCCCAGCAGCAGCGCCAGCAGCCACAGCCAAAGCCCCAGCCCCAGCCCTACCCGCAGTTCGCCGCC
GCAAACTCAGCAGCAACCCCCGTGCCCCTCGCCACAACTCCCACGCAGGCCTCCGCCAGTCCCGTCCCGTCCGCT
CAGCGCCCTTCAAGCGGTAGCGCCACGCCGTCAGCCGTCGGAAAGTGA
Gene >Ophcf2|01944
ATGACTGAGGTCGGGCACGTCGAACTGTCGAGGATACTTCAGTCCAGGCGCCATGAGTGCAGGTAAGAGGTTTTC
CATCGGCAAGAGCGATTTTTTGCGATGCCGTCGATATCATTTTTATTGTGCTAACCTTGCGCAGTTCAATTGTGA
CGGCGCGGAAGCGAAAGCTGCGTGAGCTCTTCGCGGTCGCGACACAGGTCGAGCCGCTACCGGACGAAGGCTTCG
CCAACCTCGACGCTCCGGCGGCCACACAGGCAGAATGGCAGTTTCTGCAAGCAAGCGACATGTTACAGTACGTCT
GCCGATTTGGCTTTCTTTTTATCCCCCCCCCCCCATTAGTCTTTTGCTTGTCGCCCGCCGTCATTTCGTCGCTTG
GAAACCCGTCCCAACAATTCCATGCTCTCGAAATCCCCTGTCGCGCTTCGCTTGACTGACTTTCCGTCGTACAGG
GCCAGGACTTTGACCGAGTCGAATATCCCCGAGCGGCCGCGCGTGTCACTGGAAAGATTGAAGCGGTTGGTCGCC
GAGTCGGTCAACGCCGCCATCAGCTGTTCGTCGTTGGACGCGCCGAGTTCACAGAACGCGCTATCCGAGGCCCGT
CATGGCGTCAACTGGAACAAGAGTGGAGGAGCTATCGCGAAGAGATCGACGACCCCGATTCAGCCAAAGATGGCA
GCCATTGCGCAACCGCAGCCGCCCTCGATCATCATCGCTCCGTGCACGAAGCAACTTCTCAAAGCGAGTCCACAT
TACGTCGATACCATCGAGTCGGCTGTCAAAGATGTCGGCAGCGGCGATCCGCGCAAGGTCAACGGCGACACCAGT
GTGCACAAGAAGAAGGAAGCTGTTTCGAGACGGACGCCTCAAGTTACATTTCCTCCAGGCACCAAGGGCTCAACG
ACGGATCCCATCAGCGATGCGACTCCGGGTCCCAAATCCGGCAGCGTACAGAGCAAGGTCAACGGACACCCCGGC
GTTGATGCTGCCGATTCGCACGAAGAGGGCGACGGCTTGCTGTCGATTAAGCTCCCCTCGGATAATTCCAGGGTC
CCCGATGCTCTGTCGACGCCTGCATCCAGTGTGCCCAGCGCGACGACTCCTGCCGTTCATGATGCCTCGACGGAT
ACCAGCCCCGACCGTGATGGCCCGAGTTATTCGGATGCGGCCAGGAGAAAGGAGTCGGATGCGAGCAGCGAGTCG
AGCAGCCAAGGCAGCGTCACCGACGTCAGAGCCAGGATCTTGAGCGCAGGCAATCGCCGGCCGCAGGCGCCCGCC
TTTCCCACGGCAGTTCAGAAAGAAAGCGATGTGACGGCCGCGAGTCGAAGCCAGTCCGGCGGCGAGATCGGCCTT
GCGGGCGACATGTCGGCCAACGACGGCCACGGTGAGACGAATCCCGGCTCCCATGGGCTCCAGCCGCCCGTTTCT
GCTTCGGCCCATCGCCCGCTGCCGACTGAGGTGCCCGATAGTCAAGACGACTCTCCGGAAGAGACGGGGGCGGAT
GCTCTTCACCAAGTCAAGCCTGAGGCCGAGGACTCTGCTGTGCTGCCTCCACCAAAATCAAGCAGTGCCACTGCC
GACGCTGCCTCTGGCCTAGTCATCGACACCAAATCTCAGCCACGGGAGGAACAAGATGGGCCGGCGCGGGCAGTG
ACGAGAGTCTCGACGGGCGCTATCCGGCGCAAGTCTGTCAACGAAATTGTCGGCGGCTCGTCAGGCGTCGCGACA
CGGGACGCCGTCGGCCATGGGCCTCACGATCAGCTCACTCCCGTGACGTCAACGCCTCAGTCTCCCTCCCGGATG
AGGAGTACTGGCTCGACACGGAAAGAAAGGTCCAAGAGCCACGCGTCGATGGTTTTGTTCGGCAAGCAGCCTAAG
CGGCTGGAGGACAAAGCTCTCGCGGCCGGCCACAAGGAAACGATCCAGATCTCGGACGACTACTACACGCCTCTC
TTCGTGCAAAACTTCACTGGTGTCGCCAAGTGGATGCAGCCCCTGGACCGAGTCCTCTTCCAGGCCAACAAAACA
GTGTCCACTCCTGACACGCAGCTGGTTTTTCAGGACCACCAGGCCTGCAGGATCCTTCGCAAAGTCTACCACCTG
CAGCAGAACGACAAGTGGTCCCTGCGTCAGCCCAAGCGGTGCCAGGAACCGACCAGGCCGCCCTGCCAGTGGGAC
GTGATGCTTCGGGAGATGAGGTGGATGCGCACTGATTTCCGCGAGGAGCGCAAGTGGAAGATGGTCGTCGCGCGA
AACTTGGCGTATGCCTGTGCTGAGTGGCATGAAGCCGGGCCCGAAGAACGGAAGGAAATGCAGGTGTTGGCGACG
ATTCCTCCCAGAGCGCAGCCCGCCGAGCTGGACGTTTCCATGGTCGATGCGGGCGATGACGATGACGATCTGCCG
AGGGATCATCCTACGCCGGATCTCGTGCCATCTGGAGAGGGGAACTCGCCTCAAGATATGGATGAGCTCGCCGAG
GCCTTTGACGAGCTGGCGGCGCCGTCTGCCATCTTTTCCCTGCACGATGATGACGTCGTCTTCGGCCTGCGGCGG
ACGGCGACTGCGGATAAGTTGCTGGGGGAGCTTCCCATGTATGGGCTGCCGCTCAGAGTACCCAAGGCGGATATG
ACGAGTCCGGAATACGACCCTGACGCACACTGGCGCCGCCCTGCCCTGCCGCTCAGCAAGTATGTCGAGGGGCAT
ATGAAGCTGGTGACCAGCTGCCCTCCCCGGAAGGCTAGCCGTTTCAGCTACGATGACGAGGACGAAGACGCTGAC
GGGGACGGCCTTTTTATCGACAACCACCACTCCGATCTCGGCGTCAAGCTGCCGCCCATGACGGATGAGGTGTCT
CTGTTCCATCCCGACTCGAAGCACATCCGGGATCGCCTGCACGCGGGTCACCAGTTCCGACCCCCGTCGGAGCAT
CCCATGCCGAACCAGAGCTTCTATGAATCTCGCAGCCCCTCTCAGTGGACGCTGGCCGAGGACGATGAGCTCCGT
GGACTCGTCCGGGAGTACTCGTACAACTGGTCCCTCATTTCCAACATGCTGTCGACTCGCTCCAGCTTCGTGTCT
GGTGCGGAGCGACGAACGCCCTGGGAGTGCTTCGAACGGTGGATCAACCTCGAAGGCCTGCCGGCGGACATGCAG
AAGACGCAGTACTTCAAGGCCTACAACTCGAGGATCGAGATGGCGCAGAGAATCATCGCTCAGCACAACCAACTG
GCTGCGCAACAGGCCAGCGCTTCAGGGGGGGGCGTGGCGCCGATGCGTAGGAGGCCATCGGCGCCGATGCGGGTG
GAGAAGCGACGAAACCAGAAGCACCTGGCCATGCTGGACGCGATGCGGAAGCTGGCCAAGAAGAAGGAGACTGCG
GCGCAGAAGCAGCAGCACGCGGCGGCTCAGAGCGCTGCCAGCAAGAAGGCCTGCGACGCCGTCCCCCAGCGACCG
ATCAAGACTCCGAGGGATTACAGTCTGATTCGATGGGAGAGGGACCAGGCTCTGGCTGAGAAGATGGCTCAGTTC
GCGTCGCGTCAAGAGGCTCAGCGACGAGCCGCTATACAAGCCAGAGCACAACAGCATGCGCAGGCTGCTCACATG
GCCGGAGCGCAGGGATCGGGCATGATGGGCCAGAACGCGGGTCATCAGATGGGACCCAACGTCGGCGTCAACGGG
GCGCGTCCGATGACGGCACAGAACCGGCCCCGGATGCCGATGCAGGCGCCCGTCAGCAACGGAGTCGGTCCGGCT
CCGACGCAGATGAACGGCAGCCTCTCGGCCCCGTCGCAGACGAGCGCCGCGGCGGCGCAACCGCAGGCACAGCAC
AGGATGCCGACGATGCCGCCCAACACGCAGCAGCAGGGTCAGCAGCCCGATGCCAGCCTGATGATGCGGGCCCAG
CGCATCTCGGAGCAGCAGCGTGCCGCCGTTCAGATTCAGCAGGCTCAGCAGCAGGGTCATCCGCAGCAGCAGTCG
CTGGCTCAGCAGCAACAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCCGCCTGTCAACTCGGGCACT
CCCAACAACGGAACGGGCCAGCTCAACTCTCCGTCGATGCGCAACGGCGTCAACCAGCAGTCCTTTATGAACAAC
GCCCAGGCCATGATGGCCTCTTACGCTGCCAATGGCAACGGACTGGGCTCGCCGTTACCGAGCGGCCTGCACATG
CCTGCCGCCGCCAACGTCCCGTCTCCCGGACAGAGGATGCATTCGCAGTTACCGCCAAACGTCGCCGCTCAGCTC
AGCCATCTGGAGGCCTCGTTTCGAGCTAAGAAGCCGAACCTGACCCCGGAGCAGGCGCGGCAGCTGGCGACGGAA
CATCTGACGCGAGCCATGATGACACAGCGGCAGAACGCCATGAACGCTGCTGCCGGAGCGTCTGCACAGCCGGGC
GTCGCCAACAGCGTGGCGGCCACGACGACGAGCCCTCATCAGTACGCTGCCCTGCTCCGACAGCAGCAGCAGGCA
CAGCAGCAGGTCCCTCAGCAGGCGGCACACCCTCTGAAGGCGCAGCAGGCGCAGCATCTGCAACACCAGCAGCAT
CAGCAGCATCTGCTTCACCTTCACCAGCAGCAGGCCCAGGCTCAGCAACAGCAGCAGGCTCAGCAACAGCAGCAG
GCTCAGCAACAGGCTCAGCAACAACAGGCTCAGCAACAACAGGCTCAGCAACAGCAGCAAGCCCAGCAACAACAG
CAAGCCCAGCAACAACAAGCCCAGCAGCAGCGCCAGCAGCCACAGCCAAAGCCCCAGCCCCAGCCCTACCCGCAG
TTCGCCGCCGCAAACTCAGCAGCAACCCCCGTGCCCCTCGCCACAACTCCCACGCAGGCCTCCGCCAGTCCCGTC
CCGTCCGCTCAGCGCCCTTCAAGCGGTAGCGCCACGCCGTCAGCCGTCGGAAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail