Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01933
Gene name
Locationscaffold_02:2123707..2124297
Strand-
Gene length (bp)590
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17254 DUF5321 Family of unknown function (DUF5321) 1.2E-51 31 169

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 67 86 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 111.63 58.86 164.39
Alive In ants, during behavior modification 77.12 37.45 116.79
Dead In ants, recently dead 81.00 40.13 121.87

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.091353 no
Alive Dead 0.835145 no
Dead Fungus 0.135912 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01933
MMLSRCAGQARALISSRLIPLQLRRYGSAPATVADVGFWKSLVPKTWRQENQDGEPRPKSKGWNPATYFIVMFLF
IGSMSIQMIVLRKEMEQHARRSSVKIALLREIVEKIRNGESVDVEKALGTGDAEREANWEEVLRSIERGETRRKP
SKQSLSGDKTANDQGGAQKKTAGIEGFF*
Coding >Ophcf2|01933
ATGATGCTATCGAGATGCGCAGGTCAGGCCCGGGCCCTAATTTCGAGTCGGCTGATCCCACTACAGCTCCGGAGA
TACGGCAGCGCTCCCGCCACCGTCGCCGACGTCGGCTTCTGGAAGTCGCTAGTCCCCAAGACCTGGCGACAGGAG
AATCAAGATGGCGAGCCGCGACCCAAGTCCAAGGGTTGGAACCCGGCGACGTACTTTATCGTCATGTTTCTCTTC
ATCGGATCCATGTCCATCCAGATGATTGTGCTGCGCAAGGAGATGGAGCAGCACGCACGTCGGTCATCCGTCAAG
ATAGCGTTACTGCGCGAGATTGTCGAAAAGATTCGCAACGGGGAAAGCGTCGACGTCGAAAAGGCGCTGGGCACG
GGCGATGCCGAGAGAGAGGCCAATTGGGAAGAGGTGCTGCGATCAATTGAACGCGGCGAGACGCGACGCAAGCCA
TCCAAGCAATCCTTGTCGGGGGACAAGACAGCCAACGATCAGGGCGGTGCTCAGAAGAAGACGGCTGGCATCGAA
GGCTTCTTCTGA
Transcript >Ophcf2|01933
ATGATGCTATCGAGATGCGCAGGTCAGGCCCGGGCCCTAATTTCGAGTCGGCTGATCCCACTACAGCTCCGGAGA
TACGGCAGCGCTCCCGCCACCGTCGCCGACGTCGGCTTCTGGAAGTCGCTAGTCCCCAAGACCTGGCGACAGGAG
AATCAAGATGGCGAGCCGCGACCCAAGTCCAAGGGTTGGAACCCGGCGACGTACTTTATCGTCATGTTTCTCTTC
ATCGGATCCATGTCCATCCAGATGATTGTGCTGCGCAAGGAGATGGAGCAGCACGCACGTCGGTCATCCGTCAAG
ATAGCGTTACTGCGCGAGATTGTCGAAAAGATTCGCAACGGGGAAAGCGTCGACGTCGAAAAGGCGCTGGGCACG
GGCGATGCCGAGAGAGAGGCCAATTGGGAAGAGGTGCTGCGATCAATTGAACGCGGCGAGACGCGACGCAAGCCA
TCCAAGCAATCCTTGTCGGGGGACAAGACAGCCAACGATCAGGGCGGTGCTCAGAAGAAGACGGCTGGCATCGAA
GGCTTCTTCTGA
Gene >Ophcf2|01933
ATGATGCTATCGAGATGCGCAGGTCAGGCCCGGGCCCTAATTTCGAGTCGGCTGATCCCACTACAGCTCCGGAGA
TACGGCAGCGCTCCCGCCACCGTCGCCGACGTCGGCTTCTGGAAGTCGCTAGTCCCCAAGACCTGGCGACAGGAG
AATCAAGATGGCGAGCCGCGACCCAAGTCCAAGGGTTGGAACCCGGCGACGTACTTTATCGTCATGTTTCTCTTC
ATCGGATCCATGTCCATCCAGATGATTGTGCTGCGCAAGGAGATGGAGCAGCACGCACGTCGGTCATCCGTCAAG
ATAGCGTTACTGCGCGAGATTGTCGAAAAGATTCGCAACGGGGAAAGCGTCGACGTCGAAAAGGCGCTGGGCACG
GGCGATGCCGAGAGAGAGGCCAATTGGGAAGAGGGTGAGTCGCAACAACGGGCAAGCAGTCGAACCTGGCTAAGA
CACAGACGATAGTGCTGCGATCAATTGAACGCGGCGAGACGCGACGCAAGCCATCCAAGCAATCCTTGTCGGGGG
ACAAGACAGCCAACGATCAGGGCGGTGCTCAGAAGAAGACGGCTGGCATCGAAGGCTTCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail