Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01930
Gene name
Locationscaffold_02:2118647..2119226
Strand-
Gene length (bp)579
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 128 150 22
3 152 174 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 9.01 2.01 16.01
Alive In ants, during behavior modification 36.86 14.79 58.93
Dead In ants, recently dead 25.22 9.57 40.87

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.105646 no
Dead Fungus 0.001768 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01930
MKISASITALLAATVLAAPTPKQANQVSAAAVAEADQNPARIIIDPGLDSSKSGEVTSIDSVVVPGSSSAAGAGG
QVSAATLGLGRLRRQQRRTRRFIRRFGFFPGAFGGFGLGAFGGFGGLGFPGLGGGFGFGGVGGFGGVGGFGGLGV
PGAGLGVGGIGLGGGLGGFPVGSVPSQLGILGPQFLGPAILP*
Coding >Ophcf2|01930
ATGAAAATCAGCGCCTCGATAACAGCTCTCCTGGCCGCGACCGTCCTCGCAGCGCCAACCCCAAAACAAGCCAAC
CAAGTCAGCGCCGCCGCCGTCGCAGAAGCAGACCAAAACCCAGCCCGCATCATCATAGACCCGGGCCTCGACAGC
AGCAAATCCGGAGAAGTCACGTCCATCGACTCCGTCGTCGTGCCGGGCAGCAGCAGCGCGGCCGGTGCCGGCGGT
CAAGTCAGCGCCGCGACTCTCGGGCTGGGGAGACTTCGGAGGCAGCAGAGGAGGACGCGGCGCTTCATCAGGAGG
TTCGGCTTCTTCCCCGGGGCCTTTGGCGGGTTTGGTCTCGGGGCTTTTGGAGGCTTTGGTGGTCTTGGCTTTCCC
GGCTTGGGCGGTGGCTTTGGCTTCGGCGGCGTGGGAGGCTTCGGCGGTGTGGGGGGATTCGGCGGCTTGGGAGTT
CCCGGGGCGGGACTCGGTGTCGGAGGGATCGGTCTCGGGGGCGGTCTCGGAGGGTTTCCCGTCGGCTCGGTTCCC
AGCCAGCTGGGCATTCTCGGTCCGCAGTTTCTTGGGCCTGCTATCCTTCCCTAG
Transcript >Ophcf2|01930
ATGAAAATCAGCGCCTCGATAACAGCTCTCCTGGCCGCGACCGTCCTCGCAGCGCCAACCCCAAAACAAGCCAAC
CAAGTCAGCGCCGCCGCCGTCGCAGAAGCAGACCAAAACCCAGCCCGCATCATCATAGACCCGGGCCTCGACAGC
AGCAAATCCGGAGAAGTCACGTCCATCGACTCCGTCGTCGTGCCGGGCAGCAGCAGCGCGGCCGGTGCCGGCGGT
CAAGTCAGCGCCGCGACTCTCGGGCTGGGGAGACTTCGGAGGCAGCAGAGGAGGACGCGGCGCTTCATCAGGAGG
TTCGGCTTCTTCCCCGGGGCCTTTGGCGGGTTTGGTCTCGGGGCTTTTGGAGGCTTTGGTGGTCTTGGCTTTCCC
GGCTTGGGCGGTGGCTTTGGCTTCGGCGGCGTGGGAGGCTTCGGCGGTGTGGGGGGATTCGGCGGCTTGGGAGTT
CCCGGGGCGGGACTCGGTGTCGGAGGGATCGGTCTCGGGGGCGGTCTCGGAGGGTTTCCCGTCGGCTCGGTTCCC
AGCCAGCTGGGCATTCTCGGTCCGCAGTTTCTTGGGCCTGCTATCCTTCCCTAG
Gene >Ophcf2|01930
ATGAAAATCAGCGCCTCGATAACAGCTCTCCTGGCCGCGACCGTCCTCGCAGCGCCAACCCCAAAACAAGCCAAC
CAAGTCAGCGCCGCCGCCGTCGCAGAAGCAGACCAAAACCCAGCCCGCATCATCATAGACCCGGGCCTCGACAGC
AGCAAATCCGGAGAAGTCACGTCCATCGACTCCGTCGTCGTGCCGGGCAGCAGCAGCGCGGCCGGTGCCGGCGGT
CAAGTCAGCGCCGCGACTCTCGGGCTGGGGAGACTTCGGAGGCAGCAGAGGAGGACGCGGCGCTTCATCAGGAGG
TTCGGCTTCTTCCCCGGGGCCTTTGGCGGGTTTGGTCTCGGGGCTTTTGGAGGCTTTGGTGGTCTTGGCTTTCCC
GGCTTGGGCGGTGGCTTTGGCTTCGGCGGCGTGGGAGGCTTCGGCGGTGTGGGGGGATTCGGCGGCTTGGGAGTT
CCCGGGGCGGGACTCGGTGTCGGAGGGATCGGTCTCGGGGGCGGTCTCGGAGGGTTTCCCGTCGGCTCGGTTCCC
AGCCAGCTGGGCATTCTCGGTCCGCAGTTTCTTGGGCCTGCTATCCTTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail