Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01928
Gene name
Locationscaffold_02:2115335..2116316
Strand+
Gene length (bp)981
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein 3.5E-82 1 237

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0008380 RNA splicing No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2323 0.7849 0.011 0.0105 0.1438 0.0018 0.0341 0.0239 0.0383 0.0163

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2958
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6260
Ophiocordyceps australis map64 (Brazil) OphauB2|6559
Ophiocordyceps camponoti-floridani Ophcf2|01928 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3016
Ophiocordyceps kimflemingae Ophio5|8438
Ophiocordyceps subramaniannii Hirsu2|5022

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01928
MTTAHRPTFDPARGKEALRGPAYHQRLLPAHKQLKYRQAGQGGDADAHEGAAQRDLAAELLAAEEAARAKRSGQA
KKLDAAFEDGGSGVGDEDEGSLRRRRVLLETRDVDADEESGADEDDDDEDDDDDDDDDEEDDEDAELQRELERVR
HERQEKKQREEKAQAEAEAQQRQRSIALGNPLLNKQDFSAAGRRRWDEDVVFKNQARGTEDKGKKKEFVNDLLRS
DFHRRFMSKYVR*
Coding >Ophcf2|01928
ATGACGACCGCTCACCGTCCGACCTTTGACCCCGCGCGCGGCAAAGAAGCCCTCCGCGGACCAGCCTACCATCAA
CGCCTCCTCCCAGCCCACAAGCAGCTCAAGTACCGACAAGCCGGCCAGGGCGGCGACGCAGACGCACACGAGGGC
GCAGCGCAGCGCGATCTGGCAGCCGAGCTGCTGGCAGCCGAGGAGGCGGCGCGGGCGAAGCGTAGCGGTCAGGCG
AAGAAGCTGGATGCGGCCTTTGAGGACGGGGGTTCTGGGGTGGGGGATGAGGATGAGGGATCTTTGCGGAGGCGG
AGGGTGTTGCTTGAGACGAGGGATGTTGATGCCGATGAGGAGAGTGGCGCGGACGAAGACGACGACGATGAAGAC
GACGATGACGACGACGACGACGACGAAGAAGATGATGAAGACGCAGAGCTACAACGCGAACTAGAACGCGTCCGT
CACGAACGCCAAGAGAAGAAACAACGCGAAGAAAAAGCCCAGGCCGAAGCCGAAGCCCAACAACGCCAACGATCA
ATCGCCCTCGGAAACCCCCTCCTCAACAAGCAAGATTTCTCGGCCGCCGGTCGGCGACGCTGGGATGAGGACGTC
GTCTTTAAGAATCAGGCCAGGGGCACGGAGGATAAGGGGAAGAAGAAGGAGTTTGTCAATGACTTGCTGCGGTCG
GATTTTCATCGGCGGTTTATGAGCAAGTATGTTCGCTGA
Transcript >Ophcf2|01928
ATGACGACCGCTCACCGTCCGACCTTTGACCCCGCGCGCGGCAAAGAAGCCCTCCGCGGACCAGCCTACCATCAA
CGCCTCCTCCCAGCCCACAAGCAGCTCAAGTACCGACAAGCCGGCCAGGGCGGCGACGCAGACGCACACGAGGGC
GCAGCGCAGCGCGATCTGGCAGCCGAGCTGCTGGCAGCCGAGGAGGCGGCGCGGGCGAAGCGTAGCGGTCAGGCG
AAGAAGCTGGATGCGGCCTTTGAGGACGGGGGTTCTGGGGTGGGGGATGAGGATGAGGGATCTTTGCGGAGGCGG
AGGGTGTTGCTTGAGACGAGGGATGTTGATGCCGATGAGGAGAGTGGCGCGGACGAAGACGACGACGATGAAGAC
GACGATGACGACGACGACGACGACGAAGAAGATGATGAAGACGCAGAGCTACAACGCGAACTAGAACGCGTCCGT
CACGAACGCCAAGAGAAGAAACAACGCGAAGAAAAAGCCCAGGCCGAAGCCGAAGCCCAACAACGCCAACGATCA
ATCGCCCTCGGAAACCCCCTCCTCAACAAGCAAGATTTCTCGGCCGCCGGTCGGCGACGCTGGGATGAGGACGTC
GTCTTTAAGAATCAGGCCAGGGGCACGGAGGATAAGGGGAAGAAGAAGGAGTTTGTCAATGACTTGCTGCGGTCG
GATTTTCATCGGCGGTTTATGAGCAAGTATGTTCGCTGA
Gene >Ophcf2|01928
ATGACGACCGCTCACCGTCCGACCTTTGACCCCGTAAGCGCATCACCTTTACCCTCACCACCCATCTAATCCAAG
CTAACGACGCCCAAAAGGCGCGCGGCAAAGAAGCCCTCCGCGGACCAGCCTACCATCAACGCCTCCTCCCAGCCC
ACAAGCAGCTCAAGTACCGACAAGCCGGCCAGGGCGGCGACGCAGACGCACACGAGGGCGCAGCGCAGCGCGATC
TGGCAGCCGAGCTGCTGGCAGCCGAGGAGGCGGCGCGGGCGAAGCGTAGCGGTCAGGCGAAGAAGCTGGATGCGG
CCTTTGAGGACGGGGGTTCTGGGGTGGGGGATGAGGATGAGGGATCTTTGCGGGTGGGGGGTGGGAAGAGAGGCT
TGAGGAGGAGGGGTTGGATGATGAGGCGGCTAAGAGGCGGAGGGTGTTGCTTGAGACGAGGGATGTTGATGCCGA
TGAGGAGAGTGGCGCGGACGAAGACGACGACGATGAAGACGACGATGACGACGACGACGACGACGAAGAAGATGA
TGAAGACGCAGAGCTACAACGCGAACTAGAACGCGTCCGTCACGAACGCCAAGAGAAGAAACAACGCGAAGTCCG
TCCATTCCCTTCCCCCCTTCCCCAAATCTCACCTGTTCTCACCAAAAAAAAAAAAACCCCCAACAGGAAAAAGCC
CAGGCCGAAGCCGAAGCCCAACAACGCCAACGATCAATCGCCCTCGGAAACCCCCTCCTCAACAAGCAAGATTTC
TCGGCCGCCGGTCGGCGACGCTGGGATGAGGACGTCGTCTTTAAGAATCAGGCCAGGGGCACGGAGGATAAGGGG
AAGAAGAAGGAGTTTGTCAATGTGAGTCCTTCTTCTTCTTCTGTGCTTTGGTTTCTCCTTGGGTTCTAGGGGGGG
AAAGGGCTGTGTTGCTGACTTTTGTAGGACTTGCTGCGGTCGGATTTTCATCGGCGGTTTATGAGCAAGTATGTT
CGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail