Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01927
Gene name
Locationscaffold_02:2111501..2114720
Strand+
Gene length (bp)3219
Transcript length (bp)2991
Coding sequence length (bp)2991
Protein length (aa) 997

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 6.6E-32 723 935
PF11522 Pik1 Yeast phosphatidylinositol-4-OH kinase Pik1 1.2E-18 109 155

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Golgi apparatus 0.5941 0.2483 0.1465 0.2004 0.0915 0.1404 0.2145 0.3367 0.669 0.0273

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup874
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6261
Ophiocordyceps australis map64 (Brazil) OphauB2|6560
Ophiocordyceps camponoti-floridani Ophcf2|01927 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1010
Ophiocordyceps kimflemingae Ophio5|685
Ophiocordyceps kimflemingae Ophio5|8439
Ophiocordyceps subramaniannii Hirsu2|5023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01927
MSWDLLQRFLESDVFNSNPFLSVSYLSRYADHVGIHHVLCNKLRQFPYEDIEFFLPQLCHLIISVDNESMALEEF
LLDLCEESATAALLTFWLFQTYLHDLSPNPQSGPFQTCRRVYNKVQHIVFGLADTARHGKIKENVLPVTVLASFV
LASVALPLIPRWAGPLAVAQARKPQPTTDVAPEPTPSPKPNRAQTVSVSTSKSRRAKESRKSAAPDGNGPSDPRS
HSSRTLSQAVATSTSRRARTPIGTKRPTALNLESLDARASSASLPLPSPRPTTRPTTPVSADMPAADNMLRRHSH
HAKASRTAEDLTLVQKTRLLRSHYFRSQTQFLTALEGISNRLVIVPKPARMSALRAELALVSRDLPAEVDVPVIC
PPTLVNGSPGKSRHHRIVRLNPAEATVLNSAEKVPYLLMVEVLRDDFTFDPETVDNRRLLASLLDGGGRSKRLFD
LSSETPRLSPTVTRGPDPVIDSVFEPTSGDLGSSPLLKAEDEAPSRYGITSRQPQAHAQTMQRLSSGATTQTSST
VLDVISPRSSGGGSASTSSSPSSRRKMTVTLPRNLANAAPDQPDFSALATHMRTASQMLAQLDATSGKRPRHEVA
AIRAKIIASMQSLEEQSFETDDQGPTFDAIIAKTSATAGGAGGSGADLDGDHDGDNVDVPLDTAPNASAGRERME
NDIKTGGVQRRGDRDDPSAAVFGEAWEAKKGRIRKSSPYGWMKNWDLVSVIVKTGADLRQEAFACQLIDVCHRIW
VDAGVDVWVKLMRILVTGESSGLIETITNGVSLHSLKRSLTLAAADSGQARQRIATLRDHFLKAFGQPESEPYRA
GVDAFKRSLAAYSIISYILQLKDRHNGNVLVDSEGHIIHIDFGFMLSNSPGSVGFEAAPFKLTHEYVDVLGGIGS
PDFEDYKKLCKQAFQALRRSADNIIDLVAMMGRDSSMPCFSVGVAHATNSLRQRFQLHLSAVEAEQFVETDLVGK
SYGSYYTRLYDTFQYRTQGIY*
Coding >Ophcf2|01927
ATGTCGTGGGACCTACTGCAGAGATTTCTCGAGTCCGACGTCTTCAATTCGAACCCCTTTCTCTCGGTCTCGTAT
CTCTCGCGATACGCCGACCATGTCGGAATTCATCATGTTCTGTGCAATAAGTTGCGCCAGTTCCCCTACGAGGAC
ATCGAGTTCTTCCTGCCCCAGCTGTGCCACCTCATAATCAGCGTCGACAACGAGTCTATGGCCCTCGAGGAGTTT
TTGTTGGATCTCTGCGAAGAGTCGGCTACGGCCGCCCTACTGACCTTTTGGCTCTTTCAGACTTACCTCCACGAC
CTCTCACCAAACCCCCAGTCGGGCCCTTTCCAGACTTGCAGGCGCGTCTACAACAAGGTCCAACACATCGTCTTC
GGCCTGGCCGACACTGCCCGGCACGGCAAGATCAAGGAGAATGTCTTGCCCGTCACCGTTCTCGCCAGCTTCGTT
CTCGCCAGCGTTGCGCTGCCATTGATACCCAGATGGGCCGGGCCACTCGCCGTCGCCCAGGCGCGAAAGCCCCAG
CCTACCACAGACGTAGCCCCGGAGCCTACCCCCAGTCCCAAGCCCAACAGGGCGCAGACCGTGTCGGTTTCCACA
TCAAAGTCAAGGCGTGCCAAGGAGTCGAGGAAGTCGGCCGCTCCCGATGGCAACGGCCCATCAGACCCACGTTCG
CATTCATCCCGGACCCTCTCGCAGGCCGTGGCCACATCGACGTCTAGGAGGGCCAGGACGCCAATCGGCACCAAG
CGGCCGACTGCACTCAACCTCGAATCTCTCGACGCCCGGGCCAGTTCAGCATCGCTGCCCTTGCCGTCGCCGAGG
CCGACCACGAGGCCGACCACGCCCGTCTCGGCCGATATGCCGGCGGCCGACAATATGCTTCGGCGGCACTCGCAC
CACGCCAAAGCCTCGCGGACCGCCGAGGACCTGACTCTTGTACAGAAGACACGTCTGTTGAGATCTCACTATTTC
AGGTCTCAGACGCAGTTTCTCACGGCTCTCGAGGGCATTTCCAACCGACTCGTCATCGTGCCCAAGCCGGCGCGT
ATGAGCGCGCTGCGAGCCGAGTTGGCCCTGGTGTCGCGAGACCTGCCGGCCGAGGTCGACGTACCCGTCATCTGC
CCCCCTACGCTGGTCAACGGTTCACCCGGCAAGAGCCGGCACCACCGAATCGTGCGGCTGAACCCGGCCGAGGCC
ACGGTGCTCAACAGTGCCGAGAAAGTACCCTACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTTGAC
CCGGAGACTGTCGATAATCGACGGCTCCTCGCCTCCTTACTCGACGGTGGCGGAAGATCCAAGCGGCTGTTCGAT
CTGTCCTCGGAGACTCCCAGGTTATCCCCGACAGTGACGCGGGGACCCGACCCCGTCATCGACAGCGTCTTCGAA
CCGACCTCGGGCGACTTGGGGAGCTCCCCTCTGCTCAAGGCCGAGGATGAGGCGCCCAGCAGATACGGGATCACC
AGTCGGCAGCCCCAGGCACATGCGCAGACGATGCAGCGTCTGTCGAGCGGGGCGACGACACAGACTTCATCGACG
GTTCTCGATGTCATCAGTCCGCGCTCGTCGGGTGGCGGCTCTGCGTCGACGTCGAGCAGTCCCAGCTCGCGGCGC
AAGATGACGGTGACGTTGCCTCGGAATCTGGCCAACGCGGCCCCCGACCAGCCCGACTTCTCGGCGCTCGCGACT
CACATGAGGACGGCGTCGCAGATGCTGGCCCAGCTCGACGCGACGAGCGGAAAGCGGCCCAGGCACGAGGTGGCG
GCCATCAGGGCCAAGATCATAGCAAGCATGCAGAGCCTGGAAGAGCAAAGCTTCGAGACGGATGATCAGGGCCCA
ACGTTTGACGCAATTATCGCCAAGACGAGCGCCACAGCAGGAGGCGCCGGTGGCAGCGGCGCAGATCTCGATGGC
GACCACGATGGCGATAATGTCGACGTGCCGCTGGACACGGCCCCCAACGCCAGCGCAGGCAGGGAGAGGATGGAG
AACGATATCAAGACGGGCGGCGTCCAACGGCGAGGCGACCGTGACGATCCCAGCGCGGCCGTGTTCGGAGAGGCC
TGGGAGGCCAAGAAGGGGCGAATCCGCAAGTCGTCACCCTACGGATGGATGAAGAACTGGGACTTGGTCAGCGTC
ATTGTGAAGACGGGGGCCGACCTTCGACAGGAGGCCTTTGCCTGTCAGCTCATAGATGTCTGCCACCGGATCTGG
GTCGATGCCGGCGTCGATGTTTGGGTCAAGCTGATGCGCATCCTGGTGACGGGGGAATCTTCGGGCCTCATCGAG
ACCATCACCAATGGCGTCTCGCTTCACTCGCTCAAGAGAAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCG
CGGCAGCGCATCGCCACGCTGCGGGACCACTTTCTCAAAGCCTTTGGACAGCCGGAGAGCGAGCCGTATAGGGCA
GGCGTCGACGCCTTCAAGCGCTCGCTCGCGGCCTACAGCATCATCTCGTACATCCTTCAGCTCAAGGATCGGCAC
AACGGCAACGTGCTCGTCGACAGTGAGGGCCACATCATCCATATCGACTTTGGCTTCATGTTGTCCAACTCACCC
GGCTCTGTCGGCTTCGAGGCGGCCCCTTTTAAGCTCACGCACGAGTACGTCGACGTGTTGGGCGGCATCGGGTCT
CCGGACTTTGAGGACTACAAGAAACTGTGCAAGCAGGCATTCCAAGCGCTGCGCCGGTCAGCAGACAACATTATC
GATCTGGTGGCCATGATGGGCCGCGATTCCAGCATGCCGTGCTTCTCGGTAGGCGTGGCCCACGCGACCAACAGC
CTACGACAGCGGTTCCAGCTGCACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTCGAGACGGATCTCGTGGGCAAG
TCGTACGGCAGCTACTACACGCGACTTTACGACACGTTCCAGTATCGGACTCAGGGCATCTACTAG
Transcript >Ophcf2|01927
ATGTCGTGGGACCTACTGCAGAGATTTCTCGAGTCCGACGTCTTCAATTCGAACCCCTTTCTCTCGGTCTCGTAT
CTCTCGCGATACGCCGACCATGTCGGAATTCATCATGTTCTGTGCAATAAGTTGCGCCAGTTCCCCTACGAGGAC
ATCGAGTTCTTCCTGCCCCAGCTGTGCCACCTCATAATCAGCGTCGACAACGAGTCTATGGCCCTCGAGGAGTTT
TTGTTGGATCTCTGCGAAGAGTCGGCTACGGCCGCCCTACTGACCTTTTGGCTCTTTCAGACTTACCTCCACGAC
CTCTCACCAAACCCCCAGTCGGGCCCTTTCCAGACTTGCAGGCGCGTCTACAACAAGGTCCAACACATCGTCTTC
GGCCTGGCCGACACTGCCCGGCACGGCAAGATCAAGGAGAATGTCTTGCCCGTCACCGTTCTCGCCAGCTTCGTT
CTCGCCAGCGTTGCGCTGCCATTGATACCCAGATGGGCCGGGCCACTCGCCGTCGCCCAGGCGCGAAAGCCCCAG
CCTACCACAGACGTAGCCCCGGAGCCTACCCCCAGTCCCAAGCCCAACAGGGCGCAGACCGTGTCGGTTTCCACA
TCAAAGTCAAGGCGTGCCAAGGAGTCGAGGAAGTCGGCCGCTCCCGATGGCAACGGCCCATCAGACCCACGTTCG
CATTCATCCCGGACCCTCTCGCAGGCCGTGGCCACATCGACGTCTAGGAGGGCCAGGACGCCAATCGGCACCAAG
CGGCCGACTGCACTCAACCTCGAATCTCTCGACGCCCGGGCCAGTTCAGCATCGCTGCCCTTGCCGTCGCCGAGG
CCGACCACGAGGCCGACCACGCCCGTCTCGGCCGATATGCCGGCGGCCGACAATATGCTTCGGCGGCACTCGCAC
CACGCCAAAGCCTCGCGGACCGCCGAGGACCTGACTCTTGTACAGAAGACACGTCTGTTGAGATCTCACTATTTC
AGGTCTCAGACGCAGTTTCTCACGGCTCTCGAGGGCATTTCCAACCGACTCGTCATCGTGCCCAAGCCGGCGCGT
ATGAGCGCGCTGCGAGCCGAGTTGGCCCTGGTGTCGCGAGACCTGCCGGCCGAGGTCGACGTACCCGTCATCTGC
CCCCCTACGCTGGTCAACGGTTCACCCGGCAAGAGCCGGCACCACCGAATCGTGCGGCTGAACCCGGCCGAGGCC
ACGGTGCTCAACAGTGCCGAGAAAGTACCCTACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTTGAC
CCGGAGACTGTCGATAATCGACGGCTCCTCGCCTCCTTACTCGACGGTGGCGGAAGATCCAAGCGGCTGTTCGAT
CTGTCCTCGGAGACTCCCAGGTTATCCCCGACAGTGACGCGGGGACCCGACCCCGTCATCGACAGCGTCTTCGAA
CCGACCTCGGGCGACTTGGGGAGCTCCCCTCTGCTCAAGGCCGAGGATGAGGCGCCCAGCAGATACGGGATCACC
AGTCGGCAGCCCCAGGCACATGCGCAGACGATGCAGCGTCTGTCGAGCGGGGCGACGACACAGACTTCATCGACG
GTTCTCGATGTCATCAGTCCGCGCTCGTCGGGTGGCGGCTCTGCGTCGACGTCGAGCAGTCCCAGCTCGCGGCGC
AAGATGACGGTGACGTTGCCTCGGAATCTGGCCAACGCGGCCCCCGACCAGCCCGACTTCTCGGCGCTCGCGACT
CACATGAGGACGGCGTCGCAGATGCTGGCCCAGCTCGACGCGACGAGCGGAAAGCGGCCCAGGCACGAGGTGGCG
GCCATCAGGGCCAAGATCATAGCAAGCATGCAGAGCCTGGAAGAGCAAAGCTTCGAGACGGATGATCAGGGCCCA
ACGTTTGACGCAATTATCGCCAAGACGAGCGCCACAGCAGGAGGCGCCGGTGGCAGCGGCGCAGATCTCGATGGC
GACCACGATGGCGATAATGTCGACGTGCCGCTGGACACGGCCCCCAACGCCAGCGCAGGCAGGGAGAGGATGGAG
AACGATATCAAGACGGGCGGCGTCCAACGGCGAGGCGACCGTGACGATCCCAGCGCGGCCGTGTTCGGAGAGGCC
TGGGAGGCCAAGAAGGGGCGAATCCGCAAGTCGTCACCCTACGGATGGATGAAGAACTGGGACTTGGTCAGCGTC
ATTGTGAAGACGGGGGCCGACCTTCGACAGGAGGCCTTTGCCTGTCAGCTCATAGATGTCTGCCACCGGATCTGG
GTCGATGCCGGCGTCGATGTTTGGGTCAAGCTGATGCGCATCCTGGTGACGGGGGAATCTTCGGGCCTCATCGAG
ACCATCACCAATGGCGTCTCGCTTCACTCGCTCAAGAGAAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCG
CGGCAGCGCATCGCCACGCTGCGGGACCACTTTCTCAAAGCCTTTGGACAGCCGGAGAGCGAGCCGTATAGGGCA
GGCGTCGACGCCTTCAAGCGCTCGCTCGCGGCCTACAGCATCATCTCGTACATCCTTCAGCTCAAGGATCGGCAC
AACGGCAACGTGCTCGTCGACAGTGAGGGCCACATCATCCATATCGACTTTGGCTTCATGTTGTCCAACTCACCC
GGCTCTGTCGGCTTCGAGGCGGCCCCTTTTAAGCTCACGCACGAGTACGTCGACGTGTTGGGCGGCATCGGGTCT
CCGGACTTTGAGGACTACAAGAAACTGTGCAAGCAGGCATTCCAAGCGCTGCGCCGGTCAGCAGACAACATTATC
GATCTGGTGGCCATGATGGGCCGCGATTCCAGCATGCCGTGCTTCTCGGTAGGCGTGGCCCACGCGACCAACAGC
CTACGACAGCGGTTCCAGCTGCACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTCGAGACGGATCTCGTGGGCAAG
TCGTACGGCAGCTACTACACGCGACTTTACGACACGTTCCAGTATCGGACTCAGGGCATCTACTAG
Gene >Ophcf2|01927
ATGTCGTGGGACCTACTGCAGAGATTTCTCGAGTCCGACGTCTTCAATTCGAACCCCTTTCTCTCGGTCTCGTAT
CTCTCGTGCGTCCGGACTGCCCGCTCAGCATTGTCTGTTTTCGCTGACGGCTCGGTAGGCGATACGCCGACCATG
TCGGAATTCATCATGTTCTGTGCAATAAGTTGCGCCAGTTCCCCTACGAGGACATCGAGTTCTTCCTGCCCCAGC
TGTGCCACCTCATAATCAGCGTCGACAACGAGTCTATGGCCCTCGAGGAGTTTTTGTTGGATCTCTGCGAAGAGT
CGGCTACGGCCGCCCTACTGGTATTGTGTCCATGTCTCCCTTTCCGAAACAGCATCGCCGCTGACGGCCGCCCGC
CCGCGCTGAAGACCTTTTGGCTCTTTCAGACTTACCTCCACGACCTCTCACCAAACCCCCAGTCGGGCCCTTTCC
AGACTTGCAGGCGCGTCTACAACAAGGTCCAACACATCGTCTTCGGCCTGGCCGACACTGCCCGGCACGGCAAGA
TCAAGGAGAATGTCTTGCCCGTCACCGTTCTCGCCAGCTTCGTTCTCGCCAGCGTTGCGCTGCCATTGATACCCA
GATGGGCCGGGCCACTCGCCGTCGCCCAGGCGCGAAAGCCCCAGCCTACCACAGACGTAGCCCCGGAGCCTACCC
CCAGTCCCAAGCCCAACAGGGCGCAGACCGTGTCGGTTTCCACATCAAAGTCAAGGCGTGCCAAGGAGTCGAGGA
AGTCGGCCGCTCCCGATGGCAACGGCCCATCAGACCCACGTTCGCATTCATCCCGGACCCTCTCGCAGGCCGTGG
CCACATCGACGTCTAGGAGGGCCAGGACGCCAATCGGCACCAAGCGGCCGACTGCACTCAACCTCGAATCTCTCG
ACGCCCGGGCCAGTTCAGCATCGCTGCCCTTGCCGTCGCCGAGGCCGACCACGAGGCCGACCACGCCCGTCTCGG
CCGATATGCCGGCGGCCGACAATATGCTTCGGCGGCACTCGCACCACGCCAAAGCCTCGCGGACCGCCGAGGACC
TGACTCTTGTACAGAAGACACGTCTGTTGAGATCTCACTATTTCAGGTCTCAGACGCAGTTTCTCACGGCTCTCG
AGGGCATTTCCAACCGACTCGTCATCGTGCCCAAGCCGGCGCGTATGAGCGCGCTGCGAGCCGAGTTGGCCCTGG
TGTCGCGAGACCTGCCGGCCGAGGTCGACGTACCCGTCATCTGCCCCCCTACGCTGGTCAACGGTTCACCCGGCA
AGAGCCGGCACCACCGAATCGTGCGGCTGAACCCGGCCGAGGCCACGGTGCTCAACAGTGCCGAGAAAGTACCCT
ACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTTGACCCGGAGACTGTCGATAATCGACGGCTCCTCG
CCTCCTTACTCGACGGTGGCGGAAGATCCAAGCGGCTGTTCGATCTGTCCTCGGAGACTCCCAGGTTATCCCCGA
CAGTGACGCGGGGACCCGACCCCGTCATCGACAGCGTCTTCGAACCGACCTCGGGCGACTTGGGGAGCTCCCCTC
TGCTCAAGGCCGAGGATGAGGCGCCCAGCAGATACGGGATCACCAGTCGGCAGCCCCAGGCACATGCGCAGACGA
TGCAGCGTCTGTCGAGCGGGGCGACGACACAGACTTCATCGACGGTTCTCGATGTCATCAGTCCGCGCTCGTCGG
GTGGCGGCTCTGCGTCGACGTCGAGCAGTCCCAGCTCGCGGCGCAAGATGACGGTGACGTTGCCTCGGAATCTGG
CCAACGCGGCCCCCGACCAGCCCGACTTCTCGGCGCTCGCGACTCACATGAGGACGGCGTCGCAGATGCTGGCCC
AGCTCGACGCGACGAGCGGAAAGCGGCCCAGGCACGAGGTGGCGGCCATCAGGGCCAAGATCATAGCAAGCATGC
AGAGCCTGGAAGAGCAAAGCTTCGAGACGGATGATCAGGGCCCAACGTTTGACGCAATTATCGCCAAGACGAGCG
CCACAGCAGGAGGCGCCGGTGGCAGCGGCGCAGATCTCGATGGCGACCACGATGGCGATAATGTCGACGTGCCGC
TGGACACGGCCCCCAACGCCAGCGCAGGCAGGGAGAGGATGGAGAACGATATCAAGACGGGCGGCGTCCAACGGC
GAGGCGACCGTGACGATCCCAGCGCGGCCGTGTTCGGAGAGGCCTGGGAGGCCAAGAAGGGGCGAATCCGCAAGT
CGTCACCCTACGGATGGATGAAGAACTGGGACTTGGTCAGCGTCATTGTGAAGACGGGGGCCGACCTTCGACAGG
AGGCCTTTGCCTGTCAGCTCATAGATGTCTGCCACCGGATCTGGGTCGATGCCGGCGTCGATGTTTGGGTCAAGC
TGATGCGCATCCTGGTGACGGGGGAATCTTCGGGCCTCATCGAGACCATCACCAATGGCGTCTCGCTTCACTCGC
TCAAGAGAAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCGCGGCAGCGCATCGCCACGCTGCGGGACCACT
TTCTCAAAGCCTTTGGACAGCCGGAGAGCGAGCCGTATAGGGCAGGCGTCGACGCCTTCAAGCGCTCGCTCGCGG
CCTACAGCATCATCTCGTACATCCTTCAGCTCAAGGATCGGCACAACGGCAACGTGCTCGTCGACAGTGAGGGCC
ACATCATCCATATCGACTTTGGCTTCATGTTGTCCAACTCACCCGGCTCTGTCGGCTTCGAGGCGGCCCCTTTTA
AGCTCACGCACGAGTACGTCGACGTGTTGGGCGGCATCGGGTCTCCGGACTTTGAGGACTACAAGAAACTGTGCA
AGCAGGCATTCCAAGGTGAGTCCGGGAGATGGCTTCTCACTCGGGGTGTGAGGCTGACGAGTATCAGCGCTGCGC
CGGTCAGCAGACAACATTATCGATCTGGTGGCCATGATGGGCCGCGATTCCAGCATGCCGTGCTTCTCGGTAGGC
GTGGCCCACGCGACCAACAGCCTACGACAGCGGTTCCAGCTGCACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTC
GAGACGGATCTCGTGGGCAAGTCGTACGGCAGCTACTACACGCGACTGTAGGCCAGCCCCGTCTCCCGTTTCCGT
CCGTCCGACGCTGACATGGCTTCGTCTAGTTACGACACGTTCCAGTATCGGACTCAGGGCATCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail